Protein
MIA_01435_1
Length
70 amino acids
Browser: contig02:727286-727741+
Protein function
| EGGNOG: | 0PS41 | FG05916.1 | 60S ribosomal protein l38 |
|---|---|---|---|
| SGD closest match: | S000004317 | RPL38 | 60S ribosomal protein L38 |
| CGD closest match: | CAL0000195876 | RPL38 | Ribosomal 60S subunit protein L38 |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MCA_00371_1 | 75.362% | 69 | 5.69e-33 | MCA_00371_1 |
| A0A060TIU8_BLAAD | 60.870% | 69 | 8.71e-27 | ARAD1D49522p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D49522g PE=3 SV=1 |
| A0A0J9XBP8_GEOCN | 54.795% | 73 | 1.01e-23 | Similar to Saccharomyces cerevisiae YLR325C RPL38 Protein component of the large (60S) ribosomal subunit OS=Geotrichum candidum GN=BN980_GECA08s02287g PE=3 SV=1 |
| UniRef50_Q6F450 | 56.522% | 69 | 2.31e-20 | 60S ribosomal protein L38 n=41 Tax=Eukaryota TaxID=2759 RepID=RL38_PLUXY |
| RL38_YEAST | 50.000% | 74 | 8.70e-18 | 60S ribosomal protein L38 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPL38 PE=1 SV=1 |
| A0A1D8PG16_CANAL | 48.649% | 74 | 6.49e-17 | Ribosomal 60S subunit protein L38 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RPL38 PE=3 SV=1 |
| Q6CF08_YARLI | 46.154% | 65 | 6.65e-17 | YALI0B11308p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_B11308g PE=3 SV=2 |
| A0A1E4TJC8_9ASCO | 43.478% | 69 | 1.60e-15 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_78652 PE=3 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0825
Protein family membership
- Ribosomal protein L38e (IPR002675)
Domains and repeats
None predicted.
Detailed signature matches
Protein sequence
>MIA_01435_1 MAKQITDIKGFLELARENGTKSVTIKRNADNTKFKIRSSSYLYTLTVADKEKAEKLIHTLPPNLEQKEIA
GO term prediction
Biological Process
GO:0006412 translation
Molecular Function
GO:0003735 structural constituent of ribosome
Cellular Component
GO:0005622 intracellular
GO:0005840 ribosome