Protein
MCA_00371_1
Length
69 amino acids
Gene name: RPL38
Description: Ribosomal 60S subunit protein L38
Browser: contigA:1160929-1161288+
RNA-seq: read pairs 17288, FPKM 3051.6, percentile rank 98.5% (100% = highest expression)
Protein function
| Annotation: | RPL38 | Ribosomal 60S subunit protein L38 | |
|---|---|---|---|
| KEGG: | K02923 | RP-L38e | large subunit ribosomal protein L38e |
| EGGNOG: | 0PS41 | FG05916.1 | 60S ribosomal protein l38 |
| SGD closest match: | S000004317 | RPL38 | 60S ribosomal protein L38 |
| CGD closest match: | CAL0000195876 | RPL38 | Ribosomal 60S subunit protein L38 |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MIA_01435_1 | 75.36% | 69 | 9e-32 | MIA_01435_1 |
| A0A060TIU8_BLAAD | 59.42% | 69 | 1e-26 | ARAD1D49522p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D49522g PE=3 SV=1 |
| UniRef50_E0VN30 | 66.15% | 65 | 2e-20 | 60S ribosomal protein L38, putative n=1 Tax=Pediculus humanus subsp. corporis TaxID=121224 RepID=E0VN30_PEDHC |
| A0A0J9XBP8_GEOCN | 52.78% | 72 | 7e-22 | Similar to Saccharomyces cerevisiae YLR325C RPL38 Protein component of the large (60S) ribosomal subunit OS=Geotrichum candidum GN=BN980_GECA08s02287g PE=3 SV=1 |
| RL38_YEAST | 52.70% | 74 | 4e-20 | 60S ribosomal protein L38 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPL38 PE=1 SV=1 |
| A0A1D8PG16_CANAL | 48.65% | 74 | 1e-18 | Ribosomal 60S subunit protein L38 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RPL38 PE=3 SV=1 |
| A0A1E4TJC8_9ASCO | 48.44% | 64 | 4e-18 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_78652 PE=3 SV=1 |
| Q6CF08_YARLI | 43.48% | 69 | 9e-17 | YALI0B11308p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_B11308g PE=3 SV=2 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.2545
Protein family membership
- Ribosomal protein L38e (IPR002675)
Domains and repeats
None predicted.
Detailed signature matches
Protein sequence
>MCA_00371_1 MAKEIQDIKQFLDLTRKEDAKAVTIKKNADNTKFKIRSSKYLYTLVVDDKEKAEKLIHTFPPTLEQIEI
GO term prediction
Biological Process
GO:0006412 translation
Molecular Function
GO:0003735 structural constituent of ribosome
Cellular Component
GO:0005622 intracellular
GO:0005840 ribosome