Protein

MIA_01415_1

Length
320 amino acids


Browser: contig02:661126-662214+

Protein function

EGGNOG:0PHW0ROX3Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors (By similarity)
SGD closest match:S000000189ROX3Mediator of RNA polymerase II transcription subunit 19
CGD closest match:CAL0000196428MED19Med19p

Protein alignments

%idAln lengthE-value
MCA_00664_168.263%1672.12e-79MCA_00664_1
A0A0J9XDZ0_GEOCN55.063%1586.11e-50Similar to Saccharomyces cerevisiae YBL093C ROX3 Subunit of the RNA polymerase II mediator complex OS=Geotrichum candidum GN=BN980_GECA11s02259g PE=4 SV=1
UniRef50_A0A0J9XDZ055.063%1581.25e-46Similar to Saccharomyces cerevisiae YBL093C ROX3 Subunit of the RNA polymerase II mediator complex n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9XDZ0_GEOCN
A0A167DRF4_9ASCO38.286%1751.63e-23Uncharacterized protein OS=Sugiyamaella lignohabitans GN=AWJ20_1484 PE=4 SV=1
A0A060T3X3_BLAAD37.222%1803.94e-21ARAD1A12716p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1A12716g PE=4 SV=1
MED19_YARLI37.748%1511.51e-20Mediator of RNA polymerase II transcription subunit 19 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=ROX3 PE=3 SV=1
A0A1E3PQ93_9ASCO68.333%601.12e-20Rox3-domain-containing protein (Fragment) OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_14534 PE=4 SV=1
A0A1D8PPP5_CANAL35.065%1549.07e-20Med19p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MED19 PE=4 SV=1
A0A1E4TAQ1_9ASCO60.714%561.98e-16Uncharacterized protein (Fragment) OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_17959 PE=4 SV=1
MED19_YEAST36.000%751.59e-06Mediator of RNA polymerase II transcription subunit 19 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ROX3 PE=1 SV=3

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.0508

Protein family membership

Domains and repeats

None predicted.

Detailed signature matches

Unintegrated signatures no IPR
Unintegrated signatures
  1. mobidb-lite (disord...)

Protein sequence

>MIA_01415_1
MSDNLGVYLLGDNVYEPSKPSAASNLLEIYGLGPLAASVARFDPITGEKRKLRKSYKNHIMDLPGKHEIPPRGVDQPGSV
STSRTDEAPTLLSIVYSTQSQYHNPIPVLSKEAARTAPGEEYKYKYLQPYEPDLLKRAFGGLEKTPISGIPDFDVSKLAI
PPVSKFPAENGHSGVQQPQNGHSIQQFNHHTKSNGGTPTLSSSSSTLGGSLMRSSSSSLHLSNKLHSHSSFPLSTAAAAA
AESSNEDATVMRISLKKKKRKERTHTSVSPTSSTGGMGGNSSSNGSSGSAAVAVAAAAGLGMEGHHHDAKRRKTTAITTN

GO term prediction

Biological Process

GO:0006357 regulation of transcription from RNA polymerase II promoter

Molecular Function

GO:0001104 RNA polymerase II transcription cofactor activity

Cellular Component

GO:0016592 mediator complex