Protein
MCA_00664_1
Length
296 amino acids
Gene name: ROX3
Description: Mediator of RNA polymerase II transcription subunit 19
Browser: contigA:2074498-2075459+
RNA-seq: read pairs 1651, FPKM 68.7, percentile rank 72.1% (100% = highest expression)
Protein function
Annotation: | ROX3 | Mediator of RNA polymerase II transcription subunit 19 | |
---|---|---|---|
EGGNOG: | 0PHW0 | ROX3 | Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors (By similarity) |
SGD closest match: | S000000189 | ROX3 | Mediator of RNA polymerase II transcription subunit 19 |
CGD closest match: | CAL0000196428 | MED19 | Med19p |
Protein alignments
%id | Aln length | E-value | ||
---|---|---|---|---|
MIA_01415_1 | 68.26% | 167 | 2e-78 | MIA_01415_1 |
A0A0J9XDZ0_GEOCN | 50.00% | 170 | 2e-45 | Similar to Saccharomyces cerevisiae YBL093C ROX3 Subunit of the RNA polymerase II mediator complex OS=Geotrichum candidum GN=BN980_GECA11s02259g PE=4 SV=1 |
UniRef50_A0A0J9XDZ0 | 50.00% | 170 | 4e-42 | Similar to Saccharomyces cerevisiae YBL093C ROX3 Subunit of the RNA polymerase II mediator complex n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9XDZ0_GEOCN |
A0A167DRF4_9ASCO | 50.00% | 106 | 4e-23 | Uncharacterized protein OS=Sugiyamaella lignohabitans GN=AWJ20_1484 PE=4 SV=1 |
A0A1E3PQ93_9ASCO | 62.50% | 64 | 3e-20 | Rox3-domain-containing protein (Fragment) OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_14534 PE=4 SV=1 |
A0A1D8PPP5_CANAL | 33.33% | 165 | 1e-19 | Med19p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MED19 PE=4 SV=1 |
A0A060T3X3_BLAAD | 57.33% | 75 | 4e-18 | ARAD1A12716p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1A12716g PE=4 SV=1 |
MED19_YARLI | 56.92% | 65 | 2e-15 | Mediator of RNA polymerase II transcription subunit 19 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=ROX3 PE=3 SV=1 |
A0A1E4TAQ1_9ASCO | 58.82% | 51 | 4e-13 | Uncharacterized protein (Fragment) OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_17959 PE=4 SV=1 |
MED19_YEAST | 38.36% | 73 | 4e-07 | Mediator of RNA polymerase II transcription subunit 19 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ROX3 PE=1 SV=3 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0454
Protein family membership
- Mediator complex, subunit Med19, fungi (IPR013942)
Domains and repeats
None predicted.
Detailed signature matches

Unintegrated signatures
-
mobidb-lite (disord...)
Protein sequence
>MCA_00664_1 MPSSMSDDFDVYLLGNNVFEPSKPCATQNLTELYGLGPLAASVARVNPVTGEKRKLRKSYKNQMQDLPGKHDIPPRGIDK VPGGISFSMTDGNPNTAPTLLSIVFSTQAQYQQPVPSLTWDETLTAPGEEYKYKYIQPFEPQLLNRVFGSLEKTPVTGLT DFDVSKLALGPQQANNRNAANGNINSGAEDTKSLKQGSSVVGGSLMKAAVSSGSLHLAGRLGNELNGMNGPGAESSNDDA TMMKLPHKKKKRKSHIMATSSSGNTPKSNVTTPTIMGEGHEAKRRKKSSTVPTITV
GO term prediction
Biological Process
GO:0006357 regulation of transcription from RNA polymerase II promoter
Molecular Function
GO:0001104 RNA polymerase II transcription cofactor activity
Cellular Component
GO:0016592 mediator complex