Protein

MIA_01384_1

Length
408 amino acids

Browser: contig02:558819-560046+

Protein function

EGGNOG:0PI7XRTT106Histones H3 and H4 chaperone involved in the nucleosome formation and heterochromatin silencing. Required for the deposition of H3K56ac-carrying H3-H4 complex onto newly-replicated DNA. Plays a role in the transcriptional regulation of the cell- cycle dependent histone genes by creating a repressive structure at the core histone gene promoter (By similarity)
SGD closest match:S000005150RTT106Histone chaperone RTT106
CGD closest match:CAL0000189137RTT106Histone chaperone RTT106

Protein alignments

%idAln lengthE-value
MCA_00617_142.604%3388.95e-93MCA_00617_1
A0A0J9XKK9_GEOCN47.510%2617.84e-69Similar to Saccharomyces cerevisiae YNL206C RTT106 Histone chaperone, involved in regulation of chromatin structure in both transcribed and silenced chromosomal regions OS=Geotrichum candidum GN=BN980_GECA25s00219g PE=4 SV=1
UniRef50_A0A0J9XKK947.510%2611.60e-65Similar to Saccharomyces cerevisiae YNL206C RTT106 Histone chaperone, involved in regulation of chromatin structure in both transcribed and silenced chromosomal regions n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9XKK9_GEOCN
A0A060SXC6_BLAAD32.331%2661.14e-31ARAD1A08294p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1A08294g PE=4 SV=1
A0A1E3PK93_9ASCO31.724%2907.29e-31Rtt106-domain-containing protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_50899 PE=4 SV=1
A0A1E4T9Z3_9ASCO31.250%2561.38e-28Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_124616 PE=4 SV=1
RT106_YEAST30.597%2689.57e-26Histone chaperone RTT106 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RTT106 PE=1 SV=1
RT106_YARLI29.889%2713.50e-23Histone chaperone RTT106 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=RTT106 PE=3 SV=1
RT106_CANAL25.424%2951.90e-17Histone chaperone RTT106 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RTT106 PE=3 SV=2
A0A167ERD7_9ASCO47.059%852.43e-12Rtt106p OS=Sugiyamaella lignohabitans GN=RTT106 PE=4 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.0794

Protein family membership

None predicted.

Domains and repeats

  1. Domain
  2. Domain
1 50 100 150 200 250 300 350 408

Detailed signature matches

  1. Domain IPR011993
    PH domain-like
    1. SSF50729 (PH domain...)
  2. Domain IPR013719
    Domain of unknown function DUF1747
    1. PF08512 (Rtt106)
    2. SM01287 (Rtt106_2)
Unintegrated signatures no IPR
Unintegrated signatures
  1. mobidb-lite (disord...)

Protein sequence

>MIA_01384_1
MTIDPAFAALPDGLRAQIFKAIEQYPETRNVFLALYSHFTNLYDPLESKKRKLTPTATPASAATLSNTSTTGTGATTTTT
SSIATLDVDADKCLRIPGVSVQIPVRKRLDIFLAPDGRIILQKPGASLSDPPEFSLAAAQIRAVYLLPIPEKTRPHWALL
ITQKDISAEPLLATITIDATRTVVKPVEAATGELYSGDVNDMVLLYFQRQNLEPTSAQTLPPGQNLVQVSAHRGSKDGVL
YFLPGAVIFGFKKPVLVFELGGIRAISYSSITSSTFNLIVKYKGENDEAATETEFSMIDQRNFEDINRYVDYHGLSNESL
AEERRAKVDAKAVFPDELIRASREESKKEQQQPQQSGSTTDQVNLANHDFDSEDDEDDADFGDGGDQNEDDESESGSEDE
SEDIGDSD

GO term prediction

Biological Process

None predicted.

Molecular Function

None predicted.

Cellular Component

None predicted.