MIA_01373_1
Browser: contig02:534543-535668+
Protein function
EGGNOG: | 0PFFB | RAD51 | DNA repair protein Rad51 |
---|---|---|---|
SGD closest match: | S000000897 | RAD51 | DNA repair protein RAD51 |
CGD closest match: | CAL0000180182 | RAD51 | Recombinase |
Protein alignments
%id | Aln length | E-value | ||
---|---|---|---|---|
MCA_00609_1 | 91.343% | 335 | 0.0 | MCA_00609_1 |
A0A0J9XA24_GEOCN | 91.304% | 322 | 0.0 | Similar to Saccharomyces cerevisiae YER095W RAD51 Strand exchange protein, forms a helical filament with DNA that searches for homology OS=Geotrichum candidum GN=BN980_GECA05s04762g PE=3 SV=1 |
Q59UY8_CANAL | 81.790% | 324 | 1.06e-179 | Recombinase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RAD51 PE=3 SV=1 |
UniRef50_P36601 | 80.368% | 326 | 1.62e-173 | DNA repair protein rhp51 n=206 Tax=Eukaryota TaxID=2759 RepID=RAD51_SCHPO |
Q6C1K4_YARLI | 77.576% | 330 | 8.97e-168 | YALI0F15477p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_F15477g PE=3 SV=1 |
RAD51_YEAST | 74.455% | 321 | 5.34e-152 | DNA repair protein RAD51 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RAD51 PE=1 SV=1 |
A0A167CM09_9ASCO | 81.404% | 285 | 1.35e-151 | Recombinase RAD51 OS=Sugiyamaella lignohabitans GN=RAD51 PE=3 SV=1 |
A0A060T5A1_BLAAD | 62.048% | 332 | 1.86e-131 | ARAD1C10362p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C10362g PE=3 SV=1 |
A0A1E3PNM9_9ASCO | 87.500% | 80 | 2.89e-44 | Rad51 N-terminal domain-like protein (Fragment) OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_81649 PE=4 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0043
Protein family membership
- DNA recombination and repair protein, RecA-like (IPR016467)
- DNA recombination/repair protein Rad51 (IPR011941)
Domains and repeats
-
Domain
-
Domain
-
Domain
Detailed signature matches
-
-
-
PF14520 (HHH_5)
Residue annotation
-
Walker A motif cd0...
-
ATP binding site c...
-
multimer (BRC) int...
-
Walker B motif cd0...
Protein sequence
>MIA_01373_1 MASSEEVIAVESHTSQNTTDIVGPAEEEISYGPVLISKLEGNGITSSDIRKLVEAGYNTVESIAYTPKRILLTVKGISEA KADKLLHMASQYVPMGFTTATEFHQRRSELISITTGSKQLDTLLGGGIETGSITEIFGEFRTGKSQLCHTLAVTCQLPID MGGGEGKCLYIDTEGTFRPSRLLSIGSRYGLDGNVALDNVAYARAYNADHQLQLLNQAAAMMAESRFSLLIVDSIMALYR TDFSGRGELSARQTHVAKYMRMLQRLADEFGIAVVITNQVVAQVDGAAGMFNADPKKPIGGNIIAHASTTRLSLRKGRGP QRICKIYDSPCLPESECVFAIYEDGIGDPEDPES
GO term prediction
Biological Process
GO:0000724 double-strand break repair via homologous recombination
GO:0006259 DNA metabolic process
GO:0006281 DNA repair
GO:1990426 mitotic recombination-dependent replication fork processing
Molecular Function
GO:0000150 recombinase activity
GO:0000166 nucleotide binding
GO:0003677 DNA binding
GO:0003690 double-stranded DNA binding
GO:0003697 single-stranded DNA binding
GO:0005524 ATP binding
GO:0008094 DNA-dependent ATPase activity
Cellular Component
None predicted.