Protein

MIA_01298_1

Length
220 amino acids

Browser: contig02:276359-277022+

Protein function

EGGNOG:0PIAIRPS540S ribosomal protein S5
SGD closest match:S000003884RPS540S ribosomal protein S5
CGD closest match:CAL0000175293RPS5Ribosomal 40S subunit protein S5

Protein alignments

%idAln lengthE-value
MCA_00201_195.025%2012.44e-144MCA_00201_1
A0A167FT81_9ASCO93.000%2002.15e-139Ribosomal 40S subunit protein S5 OS=Sugiyamaella lignohabitans GN=RPS5 PE=3 SV=1
A0A0J9XGS5_GEOCN92.040%2018.54e-139Similar to Saccharomyces cerevisiae YJR123W RPS5 Protein component of the small (40S) ribosomal subunit OS=Geotrichum candidum GN=BN980_GECA15s02617g PE=3 SV=1
A0A060T458_BLAAD91.500%2004.56e-137ARAD1A14410p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1A14410g PE=3 SV=1
A0A1E3PKF0_9ASCO89.500%2002.90e-134Ribosomal protein S7 OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_83398 PE=3 SV=1
Q6C2E5_YARLI87.374%1989.51e-132YALI0F08569p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_F08569g PE=3 SV=1
A0A1E4TKT4_9ASCO87.940%1995.65e-131Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_23336 PE=3 SV=1
UniRef50_Q7RVI183.500%2002.89e-12540S ribosomal protein S5 n=137 Tax=Eukaryota TaxID=2759 RepID=RS5_NEUCR
Q5AG43_CANAL86.432%1998.07e-128Ribosomal 40S subunit protein S5 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RPS5 PE=3 SV=1
RS5_YEAST78.894%1993.76e-11940S ribosomal protein S5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPS5 PE=1 SV=3

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.0009

Protein family membership

Domains and repeats

  1. Domain
1 50 100 150 220

Detailed signature matches

  1. Family IPR000235
    Ribosomal protein S5/S7
    1. PIRSF002122 (RPS7p_...)
  2. Family IPR005716
    Ribosomal protein S5/S7, eukaryotic/archaeal
    1. TIGR01028
    2. cd14867 (uS7_Eukaryote)
  3. Domain IPR023798
    Ribosomal protein S7 domain
    1. SSF47973 (Ribosomal...)
    2. G3DSA:1.10.45...
    3. PF00177 (Ribosomal_S7)
  4. SITE IPR020606
    Ribosomal protein S7, conserved site
    1. PS00052 (RIBOSOMAL_S7)
Unintegrated signatures no IPR
Unintegrated signatures
  1. Coil

Residue annotation

  1. S9 interface cd14867
  2. rRNA binding site ...
  3. S25 interface cd14...
  4. S11 interface cd14...

Protein sequence

>MIA_01298_1
MSDVEVEIEEQQEQVYVYEGFTKLPADVVAESGAIKLFNKWSFDDVEVKDISLTDYIQIRQPVYLSHSAGRYASKRFRKA
QCPIVERLTNSLMMNGRNNGKKLLAVRIVQQALEIIHLLTDQNPLQVVVDAIVNTGPREDSTRIGSSGTVRRQAVDVSPL
RRVNQAIALLTIGAREASFRNIKTIAECLAEELINAAKGSSNSYAIKKKDELERVAKSNR

GO term prediction

Biological Process

GO:0006412 translation

Molecular Function

GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome

Cellular Component

GO:0015935 small ribosomal subunit