Protein
MCA_00201_1
Length
220 amino acids
Gene name: RPS5
Description: 40S ribosomal protein S5
Browser: contigA:629341-630004-
RNA-seq: read pairs 80567, FPKM 4504.5, percentile rank 99.4% (100% = highest expression)
Protein function
| Annotation: | RPS5 | 40S ribosomal protein S5 | |
|---|---|---|---|
| KEGG: | K02989 | RP-S5e | small subunit ribosomal protein S5e |
| EGGNOG: | 0PIAI | RPS5 | 40S ribosomal protein S5 |
| SGD closest match: | S000003884 | RPS5 | 40S ribosomal protein S5 |
| CGD closest match: | CAL0000175293 | RPS5 | Ribosomal 40S subunit protein S5 |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MIA_01298_1 | 95.02% | 201 | 2e-142 | MIA_01298_1 |
| A0A167FT81_9ASCO | 90.00% | 200 | 5e-135 | Ribosomal 40S subunit protein S5 OS=Sugiyamaella lignohabitans GN=RPS5 PE=3 SV=1 |
| A0A0J9XGS5_GEOCN | 89.55% | 201 | 1e-134 | Similar to Saccharomyces cerevisiae YJR123W RPS5 Protein component of the small (40S) ribosomal subunit OS=Geotrichum candidum GN=BN980_GECA15s02617g PE=3 SV=1 |
| A0A060T458_BLAAD | 89.00% | 200 | 2e-133 | ARAD1A14410p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1A14410g PE=3 SV=1 |
| A0A1E3PSJ7_9ASCO | 87.00% | 200 | 3e-130 | Ribosomal protein S7 OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_19385 PE=3 SV=1 |
| Q6C2E5_YARLI | 86.87% | 198 | 1e-129 | YALI0F08569p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_F08569g PE=3 SV=1 |
| A0A1E4TKT4_9ASCO | 86.43% | 199 | 2e-128 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_23336 PE=3 SV=1 |
| UniRef50_Q7RVI1 | 82.50% | 200 | 4e-122 | 40S ribosomal protein S5 n=137 Tax=Eukaryota TaxID=2759 RepID=RS5_NEUCR |
| Q5AG43_CANAL | 83.92% | 199 | 3e-124 | Ribosomal 40S subunit protein S5 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RPS5 PE=3 SV=1 |
| RS5_YEAST | 78.89% | 199 | 2e-117 | 40S ribosomal protein S5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPS5 PE=1 SV=3 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0010
Protein family membership
- Ribosomal protein S5/S7 (IPR000235)
- Ribosomal protein S5/S7, eukaryotic/archaeal (IPR005716)
Domains and repeats
-
Domain
1
50
100
150
220
Detailed signature matches
-
-
PIRSF002122 (RPS7p_...)
-
-
-
-
PS00052 (RIBOSOMAL_S7)
-
Residue annotation
-
S9 interface cd14867
-
rRNA binding site ...
-
S25 interface cd14...
-
S11 interface cd14...
Protein sequence
>MCA_00201_1 MSDVEVEIEEQQEQVYVYEGFTKLPSDVVAESGSIKLFNKWSFDDVQVKDISLTDYVQIRQPVYLSHSAGRYATKRFRKA QCPIIERLTNSLMMNGRNNGKKLMAVRIVQQALEIIHLLTEQNPLQVVVDAIVNTGPREDSTRIGSSGAVRRQAVDVSPL RRVNQAIALLTIGAREASFRNIKTISECLAEELINAAKGSSNSYAIKKKDELERVAKSNR
GO term prediction
Biological Process
GO:0006412 translation
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
Cellular Component
GO:0015935 small ribosomal subunit