Protein

MIA_01294_1

Length
189 amino acids

Browser: contig02:267269-267839-

Protein function

EGGNOG:0PNS9COX20mitochondrial respiratory chain complex IV assembly
SGD closest match:S000002639COX20Cytochrome c oxidase protein 20, mitochondrial
CGD closest match:CAL0000201709orf19.6461Cytochrome c oxidase protein 20, mitochondrial

Protein alignments

%idAln lengthE-value
MCA_00207_148.701%1548.12e-35MCA_00207_1
A0A0J9XJH0_GEOCN47.368%1526.47e-29Cytochrome c oxidase protein 20, mitochondrial OS=Geotrichum candidum GN=BN980_GECA19s00692g PE=3 SV=1
UniRef50_A0A0J9XJH047.368%1521.32e-25Cytochrome c oxidase protein 20, mitochondrial n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9XJH0_GEOCN
A0A167DL29_9ASCO35.795%1761.75e-20Cytochrome c oxidase protein 20, mitochondrial OS=Sugiyamaella lignohabitans GN=COX20 PE=3 SV=1
Q6CCH4_YARLI37.363%917.35e-16Cytochrome c oxidase protein 20, mitochondrial OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_C09350g PE=3 SV=1
A0A1E3PTS1_9ASCO43.373%831.38e-15Uncharacterized protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_30472 PE=4 SV=1
A0A060TG33_BLAAD48.148%818.68e-12Cytochrome c oxidase protein 20, mitochondrial OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D19932g PE=3 SV=1
Q5AH72_CANAL27.815%1517.66e-10Cytochrome c oxidase protein 20, mitochondrial OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.6461 PE=3 SV=1
COX20_YEAST26.496%1172.36e-07Cytochrome c oxidase protein 20, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=COX20 PE=1 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.0490

Protein family membership

Domains and repeats

None predicted.

Detailed signature matches

  1. Family IPR022533
    Cox20/FAM36A
    1. PF12597 (DUF3767)
Unintegrated signatures no IPR
Unintegrated signatures
  1. CYTOPLASMIC_D... (C...)
  2. NON_CYTOPLASM... (N...)
  3. TRANSMEMBRANE (Tran...)
  4. mobidb-lite (disord...)

Protein sequence

>MIA_01294_1
MSSEDPSKQSSSQVFLEDLPPKFDESEAPPAKPSGHPVLPPRKVAPSGTGAGTPLIPPSSAAMAAAAAQYDPNKSLFTQA
LGTVQASDFGQLSNIPCFRKAMLTGGAVGAVAFGVLVTARWPARRALNWAVGGFTIGSIGSWEQCRFQMRRERRNTEMAR
EIYRNRPAAGGADGPGKEPPAGEPSAPGS

GO term prediction

Biological Process

None predicted.

Molecular Function

None predicted.

Cellular Component

None predicted.