Protein
MIA_01294_1
Length
189 amino acids
Browser: contig02:267269-267839-
Protein function
| EGGNOG: | 0PNS9 | COX20 | mitochondrial respiratory chain complex IV assembly |
|---|---|---|---|
| SGD closest match: | S000002639 | COX20 | Cytochrome c oxidase protein 20, mitochondrial |
| CGD closest match: | CAL0000201709 | orf19.6461 | Cytochrome c oxidase protein 20, mitochondrial |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MCA_00207_1 | 48.701% | 154 | 8.12e-35 | MCA_00207_1 |
| A0A0J9XJH0_GEOCN | 47.368% | 152 | 6.47e-29 | Cytochrome c oxidase protein 20, mitochondrial OS=Geotrichum candidum GN=BN980_GECA19s00692g PE=3 SV=1 |
| UniRef50_A0A0J9XJH0 | 47.368% | 152 | 1.32e-25 | Cytochrome c oxidase protein 20, mitochondrial n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9XJH0_GEOCN |
| A0A167DL29_9ASCO | 35.795% | 176 | 1.75e-20 | Cytochrome c oxidase protein 20, mitochondrial OS=Sugiyamaella lignohabitans GN=COX20 PE=3 SV=1 |
| Q6CCH4_YARLI | 37.363% | 91 | 7.35e-16 | Cytochrome c oxidase protein 20, mitochondrial OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_C09350g PE=3 SV=1 |
| A0A1E3PTS1_9ASCO | 43.373% | 83 | 1.38e-15 | Uncharacterized protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_30472 PE=4 SV=1 |
| A0A060TG33_BLAAD | 48.148% | 81 | 8.68e-12 | Cytochrome c oxidase protein 20, mitochondrial OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D19932g PE=3 SV=1 |
| Q5AH72_CANAL | 27.815% | 151 | 7.66e-10 | Cytochrome c oxidase protein 20, mitochondrial OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.6461 PE=3 SV=1 |
| COX20_YEAST | 26.496% | 117 | 2.36e-07 | Cytochrome c oxidase protein 20, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=COX20 PE=1 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0490
Protein family membership
- Cox20/FAM36A (IPR022533)
Domains and repeats
None predicted.
Detailed signature matches
-
-
PF12597 (DUF3767)
-
no IPR
Unintegrated signatures
-
CYTOPLASMIC_D... (C...)
-
NON_CYTOPLASM... (N...)
-
TRANSMEMBRANE (Tran...)
-
mobidb-lite (disord...)
Protein sequence
>MIA_01294_1 MSSEDPSKQSSSQVFLEDLPPKFDESEAPPAKPSGHPVLPPRKVAPSGTGAGTPLIPPSSAAMAAAAAQYDPNKSLFTQA LGTVQASDFGQLSNIPCFRKAMLTGGAVGAVAFGVLVTARWPARRALNWAVGGFTIGSIGSWEQCRFQMRRERRNTEMAR EIYRNRPAAGGADGPGKEPPAGEPSAPGS
GO term prediction
Biological Process
None predicted.
Molecular Function
None predicted.
Cellular Component
None predicted.