Protein
MCA_00207_1
Length
189 amino acids
Gene name: COX20
Description: Cytochrome c oxidase protein 20, mitochondrial
Browser: contigA:647704-648274+
RNA-seq: read pairs 891, FPKM 57.9, percentile rank 68.5% (100% = highest expression)
Protein function
| Annotation: | COX20 | Cytochrome c oxidase protein 20, mitochondrial | |
|---|---|---|---|
| KEGG: | K18184 | COX20 | cytochrome c oxidase assembly protein subunit 20 |
| EGGNOG: | 0PNS9 | COX20 | mitochondrial respiratory chain complex IV assembly |
| SGD closest match: | S000002639 | COX20 | Cytochrome c oxidase protein 20, mitochondrial |
| CGD closest match: | CAL0000201709 | orf19.6461 | Cytochrome c oxidase protein 20, mitochondrial |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MIA_01294_1 | 48.70% | 154 | 6e-47 | MIA_01294_1 |
| A0A0J9XJH0_GEOCN | 47.86% | 140 | 1e-40 | Cytochrome c oxidase protein 20, mitochondrial OS=Geotrichum candidum GN=BN980_GECA19s00692g PE=3 SV=1 |
| UniRef50_A0A0J9XJH0 | 47.86% | 140 | 2e-37 | Cytochrome c oxidase protein 20, mitochondrial n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9XJH0_GEOCN |
| A0A167DL29_9ASCO | 45.38% | 130 | 8e-28 | Cytochrome c oxidase protein 20, mitochondrial OS=Sugiyamaella lignohabitans GN=COX20 PE=3 SV=1 |
| Q6CCH4_YARLI | 41.49% | 94 | 5e-24 | Cytochrome c oxidase protein 20, mitochondrial OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_C09350g PE=3 SV=1 |
| A0A1E3PTS1_9ASCO | 38.55% | 83 | 4e-20 | Uncharacterized protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_30472 PE=4 SV=1 |
| A0A060TG33_BLAAD | 38.33% | 120 | 2e-19 | Cytochrome c oxidase protein 20, mitochondrial OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D19932g PE=3 SV=1 |
| Q5AH72_CANAL | 33.97% | 156 | 1e-18 | Cytochrome c oxidase protein 20, mitochondrial OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.6461 PE=3 SV=1 |
| COX20_YEAST | 31.43% | 140 | 3e-14 | Cytochrome c oxidase protein 20, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=COX20 PE=1 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.1025
Protein family membership
- Cox20/FAM36A (IPR022533)
- FAM36A (IPR023242)
- Cytochrome oxidase biogenesis protein, Cox20 subunit (IPR016529)
Domains and repeats
None predicted.
Detailed signature matches
-
-
PF12597 (DUF3767)
-
-
-
PIRSF007871 (Cox20)
-
-
-
PR02049 (PROTEINF36A)
-
no IPR
Unintegrated signatures
-
CYTOPLASMIC_D... (C...)
-
NON_CYTOPLASM... (N...)
-
TRANSMEMBRANE (Tran...)
-
mobidb-lite (disord...)
Protein sequence
>MCA_00207_1 MVWPFSRGSSSPAVDETTTTTSLETAAAAAKKEKPAIYLEDLPPKFEDQPEPVPGSPEAGASNKPTSFRGSPQKIDPNES IVKQAISSISVNDFAEVNKMPCFRNAMLTGGSVGAVAFAVLISARSPFKRALNWTVAGFTIGSIGSWEQCRYKLRQERKT QEMARQIYKNRERQQQQQSKEGEKKPEDN
GO term prediction
Biological Process
GO:0033617 mitochondrial respiratory chain complex IV assembly
Molecular Function
None predicted.
Cellular Component
GO:0005743 mitochondrial inner membrane