Protein

MIA_01196_1

Length
202 amino acids

Browser: contig02:35830-36551-

Protein function

EGGNOG:0PRGFFG10296.1Disrupter of telomere silencing protein Dot5
SGD closest match:S000001272DOT5Peroxiredoxin DOT5
CGD closest match:CAL0000195251DOT5Thioredoxin peroxidase

Protein alignments

%idAln lengthE-value
MCA_03220_149.485%1948.47e-57MCA_03220_1
UniRef50_Q6BQG044.624%1866.32e-45DEHA2E05544p n=6 Tax=Saccharomycetales TaxID=4892 RepID=Q6BQG0_DEBHA
A0A1E4TMA1_9ASCO56.154%1302.03e-46Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_30828 PE=4 SV=1
A0A1E3PRH7_9ASCO53.957%1394.38e-46Thioredoxin-like protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_82000 PE=4 SV=1
Q6C5B6_YARLI48.905%1373.54e-45YALI0E19448p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_E19448g PE=4 SV=1
A0A0J9XHL5_GEOCN50.365%1378.29e-43Similar to Saccharomyces cerevisiae YIL010W DOT5 Nuclear thiol peroxidase which functions as an alkyl-hydroperoxide reductase during post-diauxic growth OS=Geotrichum candidum GN=BN980_GECA15s01209g PE=4 SV=1
Q5A7P9_CANAL42.391%1841.90e-41Thioredoxin peroxidase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=DOT5 PE=4 SV=1
A0A167DIE3_9ASCO45.926%1357.55e-41Dot5p OS=Sugiyamaella lignohabitans GN=DOT5 PE=4 SV=1
DOT5_YEAST40.201%1991.66e-39Peroxiredoxin DOT5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DOT5 PE=1 SV=1
A0A060T9G0_BLAAD35.385%1301.66e-23ARAD1D17688p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D17688g PE=4 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.9813
Predicted cleavage: 15

Protein family membership

None predicted.

Domains and repeats

  1. Domain
1 20 40 60 80 100 120 140 160 180 202

Detailed signature matches

  1. Domain IPR012336
    Thioredoxin-like fold
    1. SSF52833 (Thioredox...)
  2. Domain IPR013766
    Thioredoxin domain
    1. PS51352 (THIOREDOXIN_2)
  3. Domain IPR000866
    Alkyl hydroperoxide reductase subunit C/ Thiol specific antioxidant
    1. PF00578 (AhpC-TSA)
Unintegrated signatures no IPR
Unintegrated signatures
  1. G3DSA:3.40.30.10
  2. SFLDS00024 (Peroxir...)
  3. cd03017 (PRX_BCP)
  4. mobidb-lite (disord...)

Residue annotation

  1. SFLDS00024
  2. catalytic triad cd...

Protein sequence

>MIA_01196_1
MLGSNASLRRSARIAATSQKLKRDFKEISSDSPDKIELSNQSNKKQRNSSTINSISAIKGEFPSIVLQDQDGNDVDIKKI
AETHSNIVIFAYPRASTPGCTKQVCGFRDIYKKLNEKKVQIYGLSADSCKAQKNFFVKQKLQYPLLSDPNYKLIDFLGAR
KIPKGVIRSYWIIQNGKIIVSKIKVSPADSFNEVVDHFSDIV

GO term prediction

Biological Process

GO:0045454 cell redox homeostasis
GO:0055114 oxidation-reduction process

Molecular Function

GO:0016209 antioxidant activity
GO:0016491 oxidoreductase activity

Cellular Component

None predicted.