Protein

MIA_01192_1

Length
161 amino acids


Browser: contig02:22295-22887-

Protein function

EGGNOG:0PGUBNAS226S proteasome non-ATPase, regulatory subunit
SGD closest match:S000001269NAS2Probable 26S proteasome regulatory subunit p27
CGD closest match:CAL0000199691orf19.2301Uncharacterized protein

Protein alignments

%idAln lengthE-value
UniRef50_R1E89041.176%1701.34e-36Putative 26s proteasome non-atpase regulatory subunit protein n=10 Tax=leotiomyceta TaxID=716546 RepID=R1E890_BOTPV
PSMD9_YEAST38.889%1625.78e-35Probable 26S proteasome regulatory subunit p27 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NAS2 PE=1 SV=1
A0A060TAA8_BLAAD39.375%1601.16e-33ARAD1D17116p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D17116g PE=4 SV=1
A0A0J9XGI2_GEOCN35.795%1764.56e-33Similar to Saccharomyces cerevisiae YIL007C NAS2 Proteasome-interacting protein involved in the assembly of the base subcomplex of the 19S proteasomal regulatory particle (RP) OS=Geotrichum candidum GN=BN980_GECA15s01220g PE=4 SV=1
MCA_03294_134.158%2022.15e-29MCA_03294_1
A0A1E3PKM4_9ASCO34.973%1831.55e-27t-SNARE OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_41839 PE=4 SV=1
A0A167DIF8_9ASCO35.484%1553.38e-27Nas2p OS=Sugiyamaella lignohabitans GN=NAS2 PE=4 SV=1
Q59WK1_CANAL36.646%1613.99e-23Uncharacterized protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.2301 PE=4 SV=1
Q6C5B5_YARLI31.176%1709.19e-16YALI0E19470p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_E19470g PE=4 SV=1
A0A1E4TGE3_9ASCO31.200%1254.24e-15Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_2499 PE=4 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.0530

Protein family membership

None predicted.

Domains and repeats

  1. Domain
1 20 40 60 80 100 120 140 161

Detailed signature matches

    1. PF00595 (PDZ)
    2. SM00228 (pdz_new)
    3. SSF50156 (PDZ domai...)
Unintegrated signatures no IPR
Unintegrated signatures
  1. cd00136 (PDZ)

Residue annotation

  1. protein binding si...

Protein sequence

>MIA_01192_1
MENSLVDQEGFPRSDINVIQIRKIRVEIIMLQNDLQSILDKIQKRLVIYYQSINTGSINSVENNLNTYNVPFAVINKVVP
GGPADVAGLKRGDKLVKFGSINASNHEKLSKISHVIESCVNMPIKLTVLREDQTNILTLVPKNWEGVGLLGCTINTLSAP
V

GO term prediction

Biological Process

None predicted.

Molecular Function

GO:0005515 protein binding

Cellular Component

None predicted.