Protein
MCA_03294_1
Length
264 amino acids
Gene name: NAS2
Description: Probable 26S proteasome regulatory subunit p27
Browser: contigB:3954540-3955335+
RNA-seq: read pairs 448, FPKM 20.9, percentile rank 42.6% (100% = highest expression)
Protein function
| Annotation: | NAS2 | Probable 26S proteasome regulatory subunit p27 | |
|---|---|---|---|
| KEGG: | K06693 | PSMD9 | 26S proteasome non-ATPase regulatory subunit 9 |
| EGGNOG: | 0PGUB | NAS2 | 26S proteasome non-ATPase, regulatory subunit |
| SGD closest match: | S000001269 | NAS2 | Probable 26S proteasome regulatory subunit p27 |
| CGD closest match: | CAL0000199691 | orf19.2301 | Uncharacterized protein |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| A0A0J9XGI2_GEOCN | 37.50% | 240 | 1e-48 | Similar to Saccharomyces cerevisiae YIL007C NAS2 Proteasome-interacting protein involved in the assembly of the base subcomplex of the 19S proteasomal regulatory particle (RP) OS=Geotrichum candidum GN=BN980_GECA15s01220g PE=4 SV=1 |
| UniRef50_A0A0J9XGI2 | 37.50% | 240 | 2e-45 | Similar to Saccharomyces cerevisiae YIL007C NAS2 Proteasome-interacting protein involved in the assembly of the base subcomplex of the 19S proteasomal regulatory particle (RP) n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9XGI2_GEOCN |
| A0A060TAA8_BLAAD | 37.87% | 235 | 5e-47 | ARAD1D17116p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D17116g PE=4 SV=1 |
| PSMD9_YEAST | 29.57% | 230 | 1e-30 | Probable 26S proteasome regulatory subunit p27 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NAS2 PE=1 SV=1 |
| Q59WK1_CANAL | 35.56% | 239 | 3e-29 | Uncharacterized protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.2301 PE=4 SV=1 |
| A0A167DIF8_9ASCO | 40.12% | 167 | 3e-28 | Nas2p OS=Sugiyamaella lignohabitans GN=NAS2 PE=4 SV=1 |
| MIA_01192_1 | 34.16% | 202 | 3e-28 | MIA_01192_1 |
| A0A1E3PKM4_9ASCO | 30.08% | 246 | 3e-26 | t-SNARE OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_41839 PE=4 SV=1 |
| Q6C5B5_YARLI | 34.21% | 228 | 5e-21 | YALI0E19470p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_E19470g PE=4 SV=1 |
| A0A1E4TGE3_9ASCO | 26.24% | 221 | 4e-20 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_2499 PE=4 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0409
Protein family membership
None predicted.
Domains and repeats
-
Domain
1
50
100
150
200
264
Detailed signature matches
no IPR
Unintegrated signatures
-
-
mobidb-lite (disord...)
Protein sequence
>MCA_03294_1 MSDIHSPSINSKSNSSKNQHQESNNGFFSPNLKFLMSEKTKVEGQLDDLIMVLESHNATMETPLVMPDGFPRADIDVHQV RIVRSQIIRLRNDLKKIMDDLQVALIEHHSKQAGNQTNGDVNNSTTSTNNTSDNNSSTTNNETTIVASYEQMTISESRTA SGSSSDNSNIEPTSNVVFAMVREVATGGPAEKSGLLTGDGIIQFGSIDASNHNNLRALAPILQVNENKKVAITVKRNEEI LSLDLIPEKNWGGRGLLGCFIVPA
GO term prediction
Biological Process
None predicted.
Molecular Function
GO:0005515 protein binding
Cellular Component
None predicted.