Protein
MIA_01152_1
Length
109 amino acids
Browser: contig01:3289199-3289597-
Protein function
EGGNOG: | 0PRWG | FG10368.1 | 60S acidic ribosomal protein P1 |
---|---|---|---|
SGD closest match: | S000002288 | RPP1B | 60S acidic ribosomal protein P1-beta |
CGD closest match: | CAL0000195487 | RPP1B | Ribosomal protein P1B |
Protein alignments
%id | Aln length | E-value | ||
---|---|---|---|---|
MCA_04666_1 | 71.739% | 92 | 2.64e-18 | MCA_04666_1 |
A0A0J9XI34_GEOCN | 65.934% | 91 | 3.57e-17 | Similar to Saccharomyces cerevisiae YDL081C RPP1A Ribosomal stalk protein P1 alpha OS=Geotrichum candidum GN=BN980_GECA19s01836g PE=3 SV=1 |
A0A1E3PJJ4_9ASCO | 60.440% | 91 | 7.37e-16 | Ribosomal protein 60S OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_46807 PE=3 SV=1 |
A0A060T588_BLAAD | 57.143% | 91 | 2.01e-15 | ARAD1C10054p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C10054g PE=3 SV=1 |
UniRef50_A0A022Y5M4 | 60.000% | 110 | 6.54e-10 | 60S acidic ribosomal protein P1 n=5 Tax=Trichophyton TaxID=5550 RepID=A0A022Y5M4_TRISD |
Q6CDT9_YARLI | 57.143% | 91 | 2.74e-13 | YALI0B21252p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_B21252g PE=3 SV=1 |
A0A1E4TFQ6_9ASCO | 60.976% | 41 | 2.91e-12 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_107738 PE=3 SV=1 |
RLA3_YEAST | 45.556% | 90 | 8.14e-12 | 60S acidic ribosomal protein P1-beta OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPP1B PE=1 SV=3 |
A0A1D8PRG5_CANAL | 48.889% | 45 | 3.51e-08 | Ribosomal protein P1B OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RPP1B PE=3 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0584
Protein family membership
- Ribosomal protein L12 family (IPR027534)
Domains and repeats
None predicted.
Detailed signature matches
-
-
MF_01478 (Ribosomal...)
-

Unintegrated signatures
-
-
NON_CYTOPLASM... (N...)
-
PF00428 (Ribosomal_60s)
-
SIGNAL_PEPTIDE (Sig...)
-
SIGNAL_PEPTID... (S...)
-
SIGNAL_PEPTID... (S...)
-
SIGNAL_PEPTID... (S...)
-
cd05831 (Ribosomal_P1)
-
mobidb-lite (disord...)
Protein sequence
>MIA_01152_1 MSTNELAASYAALILADAEVEITADNLLTLTKSAGVTGVEPIWAQLFSKALNGQNLLELLTQFSAGAAGPAAAGGAAGAS GAAAEEAAAEEEESEKEESDEDMGFGLFD
GO term prediction
Biological Process
GO:0006414 translational elongation
Molecular Function
GO:0003735 structural constituent of ribosome
Cellular Component
GO:0005622 intracellular
GO:0005840 ribosome