Protein
MCA_04666_1
Length
109 amino acids
Browser: contigC:3645438-3645880-
RNA-seq: read pairs 22552, FPKM 2533.2, percentile rank 98.1% (100% = highest expression)
Protein function
| KEGG: | K02942 | RP-LP1 | large subunit ribosomal protein LP1 |
|---|---|---|---|
| EGGNOG: | 0PRWG | FG10368.1 | 60S acidic ribosomal protein P1 |
| SGD closest match: | S000002239 | RPP1A | 60S acidic ribosomal protein P1-alpha |
| CGD closest match: | CAL0000178222 | RPP1A | 60S acidic ribosomal protein P1-A |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MIA_01152_1 | 73.15% | 108 | 4e-26 | MIA_01152_1 |
| A0A0J9XI34_GEOCN | 66.06% | 109 | 2e-24 | Similar to Saccharomyces cerevisiae YDL081C RPP1A Ribosomal stalk protein P1 alpha OS=Geotrichum candidum GN=BN980_GECA19s01836g PE=3 SV=1 |
| UniRef50_A0A022Y5M4 | 61.11% | 108 | 9e-19 | 60S acidic ribosomal protein P1 n=5 Tax=Trichophyton TaxID=5550 RepID=A0A022Y5M4_TRISD |
| A0A1E4TFQ6_9ASCO | 66.97% | 109 | 3e-23 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_107738 PE=3 SV=1 |
| A0A1E3PJJ4_9ASCO | 65.42% | 107 | 1e-22 | Ribosomal protein 60S OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_46807 PE=3 SV=1 |
| A0A060T588_BLAAD | 62.62% | 107 | 5e-22 | ARAD1C10054p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C10054g PE=3 SV=1 |
| RLA1_YEAST | 61.47% | 109 | 2e-19 | 60S acidic ribosomal protein P1-alpha OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPP1A PE=1 SV=4 |
| Q6CEU7_YARLI | 67.80% | 59 | 2e-18 | YALI0B12804p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_B12804g PE=3 SV=1 |
| RLA1_CANAL | 62.39% | 109 | 1e-18 | 60S acidic ribosomal protein P1-A OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RPP1A PE=3 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0203
Protein family membership
- Ribosomal protein L12 family (IPR027534)
Domains and repeats
None predicted.
Detailed signature matches
-
-
MF_01478 (Ribosomal...)
-
no IPR
Unintegrated signatures
-
-
NON_CYTOPLASM... (N...)
-
PF00428 (Ribosomal_60s)
-
SIGNAL_PEPTIDE (Sig...)
-
SIGNAL_PEPTID... (S...)
-
SIGNAL_PEPTID... (S...)
-
SIGNAL_PEPTID... (S...)
-
cd05831 (Ribosomal_P1)
-
mobidb-lite (disord...)
Protein sequence
>MCA_04666_1 MSAELAVSYAALILADAEVEISSDNLLTLTKKAGVSSVEPIWAQLYAKALAGKDVHDLLTQFSAGASAGPAAAAGGAAAG GAAAEEAAEEEKEEEKEESDDDMGFGLFD
GO term prediction
Biological Process
GO:0006414 translational elongation
Molecular Function
GO:0003735 structural constituent of ribosome
Cellular Component
GO:0005622 intracellular
GO:0005840 ribosome