Protein
MIA_01134_1
Length
168 amino acids
Browser: contig01:3244963-3245470-
Protein function
| EGGNOG: | 0PNQN | SDH4 | succinate dehydrogenase |
|---|---|---|---|
| SGD closest match: | S000004154 | SHH4 | Mitochondrial inner membrane protein SHH4 |
| CGD closest match: | CAL0000180102 | orf19.4468 | Succinate dehydrogenase [ubiquinone] cytochrome b small subunit |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MCA_02325_1 | 75.912% | 137 | 4.34e-68 | MCA_02325_1 |
| Q6CGZ0_YARLI | 60.584% | 137 | 3.94e-56 | Succinate dehydrogenase [ubiquinone] cytochrome b small subunit OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_A14784g PE=3 SV=2 |
| UniRef50_Q6CGZ0 | 60.584% | 137 | 9.12e-53 | Succinate dehydrogenase [ubiquinone] cytochrome b small subunit n=4 Tax=Saccharomycetales TaxID=4892 RepID=Q6CGZ0_YARLI |
| A0A167DMG4_9ASCO | 68.613% | 137 | 5.77e-55 | Succinate dehydrogenase [ubiquinone] cytochrome b small subunit OS=Sugiyamaella lignohabitans GN=SHH4 PE=3 SV=1 |
| A0A0J9XIN8_GEOCN | 62.857% | 140 | 2.48e-52 | Succinate dehydrogenase [ubiquinone] cytochrome b small subunit OS=Geotrichum candidum GN=BN980_GECA19s01473g PE=3 SV=1 |
| A0A060TDL8_BLAAD | 59.398% | 133 | 2.42e-52 | Succinate dehydrogenase [ubiquinone] cytochrome b small subunit OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D08118g PE=3 SV=1 |
| A0A1E3PET9_9ASCO | 53.906% | 128 | 1.65e-47 | Succinate dehydrogenase [ubiquinone] cytochrome b small subunit OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_83935 PE=3 SV=1 |
| A0A1E4TC20_9ASCO | 58.824% | 119 | 1.33e-43 | Succinate dehydrogenase [ubiquinone] cytochrome b small subunit OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_28778 PE=3 SV=1 |
| A0A1D8PD61_CANAL | 52.239% | 134 | 3.24e-38 | Succinate dehydrogenase [ubiquinone] cytochrome b small subunit OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.4468 PE=3 SV=1 |
| SHH4_YEAST | 40.152% | 132 | 5.79e-29 | Mitochondrial inner membrane protein SHH4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SHH4 PE=1 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.9903
Predicted cleavage: 46
Protein family membership
Domains and repeats
None predicted.
Detailed signature matches
-
-
cd03496 (SQR_TypeC_...)
-
no IPR
Unintegrated signatures
-
-
NON_CYTOPLASM... (N...)
-
PF05328 (CybS)
-
SIGNAL_PEPTIDE (Sig...)
-
SIGNAL_PEPTID... (S...)
-
SIGNAL_PEPTID... (S...)
-
SIGNAL_PEPTID... (S...)
-
Residue annotation
-
Iron-sulfur protei...
-
CybL subunit inter...
-
distal quinone bin...
-
proximal heme bind...
-
proximal quinone b...
Protein sequence
>MIA_01134_1 MYRSALLNNSRLFAAAAARPALRLPLTLAPVMASRRFLGTIPQPPGGIVGTVNDAVAIPPVEKSHGSYHWSFEKVAVLGL VPLVVAPFAGASLSPVLDATLGSLILIHSHLGLESCIVDYIPKRVYGSIHTAAVGALWAGTALALYGIYEIETNDIGIAA AVGKVWNA
GO term prediction
Biological Process
None predicted.
Molecular Function
None predicted.
Cellular Component
GO:0005740 mitochondrial envelope
GO:0016021 integral component of membrane