Protein
MCA_02325_1
Length
163 amino acids
Gene name: SHH4
Description: Mitochondrial inner membrane protein SHH4; Putative alternate subunit of succinate dehydrogenase (SDH)
Browser: contigB:945484-945976-
RNA-seq: read pairs 16408, FPKM 1236.2, percentile rank 97.0% (100% = highest expression)
Protein function
| Annotation: | SHH4 | Mitochondrial inner membrane protein SHH4; Putative alternate subunit of succinate dehydrogenase (SDH) | |
|---|---|---|---|
| KEGG: | K00237 | SDHD | succinate dehydrogenase (ubiquinone) membrane anchor subunit |
| EGGNOG: | 0PNQN | SDH4 | succinate dehydrogenase |
| SGD closest match: | S000004154 | SHH4 | Mitochondrial inner membrane protein SHH4 |
| CGD closest match: | CAL0000180102 | orf19.4468 | Succinate dehydrogenase [ubiquinone] cytochrome b small subunit |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MIA_01134_1 | 75.00% | 140 | 3e-66 | MIA_01134_1 |
| A0A167DMG4_9ASCO | 63.10% | 168 | 2e-55 | Succinate dehydrogenase [ubiquinone] cytochrome b small subunit OS=Sugiyamaella lignohabitans GN=SHH4 PE=3 SV=1 |
| Q6CGZ0_YARLI | 55.15% | 165 | 6e-53 | Succinate dehydrogenase [ubiquinone] cytochrome b small subunit OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_A14784g PE=3 SV=2 |
| UniRef50_Q6CGZ0 | 55.15% | 165 | 1e-49 | Succinate dehydrogenase [ubiquinone] cytochrome b small subunit n=4 Tax=Saccharomycetales TaxID=4892 RepID=Q6CGZ0_YARLI |
| A0A0J9XIN8_GEOCN | 53.89% | 180 | 9e-51 | Succinate dehydrogenase [ubiquinone] cytochrome b small subunit OS=Geotrichum candidum GN=BN980_GECA19s01473g PE=3 SV=1 |
| A0A060TDL8_BLAAD | 53.46% | 159 | 6e-47 | Succinate dehydrogenase [ubiquinone] cytochrome b small subunit OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D08118g PE=3 SV=1 |
| A0A1E3PET9_9ASCO | 52.14% | 117 | 3e-45 | Succinate dehydrogenase [ubiquinone] cytochrome b small subunit OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_83935 PE=3 SV=1 |
| A0A1E4TC20_9ASCO | 51.28% | 117 | 1e-41 | Succinate dehydrogenase [ubiquinone] cytochrome b small subunit OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_28778 PE=3 SV=1 |
| A0A1D8PD61_CANAL | 50.75% | 134 | 9e-36 | Succinate dehydrogenase [ubiquinone] cytochrome b small subunit OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.4468 PE=3 SV=1 |
| SHH4_YEAST | 38.79% | 116 | 2e-25 | Mitochondrial inner membrane protein SHH4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SHH4 PE=1 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.9965
Predicted cleavage: 21
Protein family membership
Domains and repeats
None predicted.
Detailed signature matches
-
-
cd03496 (SQR_TypeC_...)
-
no IPR
Unintegrated signatures
-
CYTOPLASMIC_D... (C...)
-
-
NON_CYTOPLASM... (N...)
-
PF05328 (CybS)
-
-
TRANSMEMBRANE (Tran...)
Residue annotation
-
Iron-sulfur protei...
-
CybL subunit inter...
-
distal quinone bin...
-
proximal heme bind...
-
proximal quinone b...
Protein sequence
>MCA_02325_1 MIRSTLLAQRTLLRPTVFRPVVGASSLAIRRSFKTIPQPPGGIIGGVNDPVPTPPVDRTHGSYHWAFEKVVVLGMVPLMV APFAGVSLSPVLDASCGALILFHSHLGLESCITDYIPKRVYGSLHNAAIGALFAGTALSLYGIYEMETNDVGLTAAVGKI WNA
GO term prediction
Biological Process
None predicted.
Molecular Function
None predicted.
Cellular Component
GO:0005740 mitochondrial envelope
GO:0016021 integral component of membrane