Protein

MIA_01069_1

Length
364 amino acids

Browser: contig01:3063450-3064596+

Protein function

EGGNOG:0PFH9FG05670.1Component of the microsomal membrane bound fatty acid elongation system, which produces the 26-carbon very long-chain fatty acids (VLCFA) from palmitate. Catalyzes the reduction of the 3-ketoacyl-CoA intermediate that is formed in each cycle of fatty acid elongation. VLCFAs serve as precursors for ceramide and sphingolipids (By similarity)
SGD closest match:S000000363IFA38Very-long-chain 3-oxoacyl-CoA reductase
CGD closest match:CAL0000189692CAALFM_CR06070WAVery-long-chain 3-oxoacyl-CoA reductase

Protein alignments

%idAln lengthE-value
MCA_02894_169.048%3369.84e-180MCA_02894_1
A0A0J9XKS3_GEOCN70.414%3382.90e-171Very-long-chain 3-oxoacyl-CoA reductase OS=Geotrichum candidum GN=BN980_GECA24s00857g PE=3 SV=1
A0A060TCJ5_BLAAD61.755%3195.94e-140Very-long-chain 3-oxoacyl-CoA reductase OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1B16940g PE=3 SV=1
A0A167E2V9_9ASCO61.392%3167.10e-139Very-long-chain 3-oxoacyl-CoA reductase OS=Sugiyamaella lignohabitans GN=IFA38 PE=3 SV=1
MKAR_YARLI58.529%3401.93e-138Very-long-chain 3-oxoacyl-CoA reductase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0A06787g PE=3 SV=1
A0A1E3PJ45_9ASCO60.870%3224.12e-133Very-long-chain 3-oxoacyl-CoA reductase OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_52027 PE=3 SV=1
UniRef50_A3LXZ356.627%3323.91e-121Very-long-chain 3-oxoacyl-CoA reductase n=237 Tax=Fungi TaxID=4751 RepID=MKAR_PICST
MKAR_CANAL59.048%3156.21e-122Very-long-chain 3-oxoacyl-CoA reductase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CAALFM_CR06070WA PE=3 SV=3
MKAR_YEAST56.187%2997.86e-117Very-long-chain 3-oxoacyl-CoA reductase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IFA38 PE=1 SV=1
A0A1E4TE59_9ASCO50.645%3102.43e-97Very-long-chain 3-oxoacyl-CoA reductase OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_26095 PE=3 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.1673

Protein family membership

Domains and repeats

  1. Domain
1 50 100 150 200 250 300 364

Detailed signature matches

  1. Family IPR002347
    Short-chain dehydrogenase/reductase SDR
    1. PR00080 (SDRFAMILY)
    2. PR00081 (GDHRDH)
    3. PF00106 (adh_short)
  2. Family IPR027533
    Very-long-chain 3-oxoacyl-CoA reductase, fungal
    1. MF_03107 (3_ketored...)
  3. Domain IPR016040
    NAD(P)-binding domain
    1. SSF51735 (NAD(P)-bi...)
  4. SITE IPR020904
    Short-chain dehydrogenase/reductase, conserved site
    1. PS00061 (ADH_SHORT)
Unintegrated signatures no IPR
Unintegrated signatures
  1. CYTOPLASMIC_D... (C...)
  2. G3DSA:3.40.50...
  3. NON_CYTOPLASM... (N...)
  4. PIRSF000126 (11-bet...)
  5. TMhelix
  6. TRANSMEMBRANE (Tran...)
  7. cd05356 (17beta-HSD...)

Residue annotation

  1. putative NAD(P) bi...
  2. active site cd05356

Protein sequence

>MIA_01069_1
MDRLEDYIENVIKSHYETHRGPTIFFATLSLIGFVHFALNFLSYFNMISDLFVRRPTDFRKYGAGKKCWAVVTGASDGIG
KEYVYQLAKKGLNVVLVSRTEEKLRALAQEVSSKYGINTKYLAFDATTDKPENYEALQKLVRSIENVTVLINNVGQSHSI
PVPFLETSQDELQNIITVNNIATLKITQAVAPKIIESTTSVGCKGLILTMGSFSGLTPTPLLATYSGSKAFLQAWSNALA
RELAPENIDVQLVLSYLVTSAMSKIRRPSALIPTPKQFVHYALKLAGTQHGGAQERYATSTPYWSHALFHWWINAVPGVW
SKFVININYRMHVSIRDRALKKAARLAGKTEEVTSSETKAIKEE

GO term prediction

Biological Process

GO:0030497 fatty acid elongation

Molecular Function

GO:0016491 oxidoreductase activity
GO:0045703 ketoreductase activity

Cellular Component

GO:0005783 endoplasmic reticulum