Protein

MIA_01038_1

Length
215 amino acids

Browser: contig01:2976435-2977083-

Protein function

EGGNOG:0PN4ZEGD2Component of the nascent polypeptide-associated complex (NAC), a dynamic component of the ribosomal exit tunnel, protecting the emerging polypeptides from interaction with other cytoplasmic proteins to ensure appropriate nascent protein targeting. The NAC complex also promotes mitochondrial protein import by enhancing productive ribosome interactions with the outer mitochondrial membrane and blocks the inappropriate interaction of ribosomes translating non-secretory nascent polypeptides with translocation sites in the membrane of the endoplasmic reticulum. Egd2 may also be involved in transcription regulation (By similarity)
SGD closest match:S000001236EGD2Nascent polypeptide-associated complex subunit alpha
CGD closest match:CAL0000185584EGD2Nascent polypeptide-associated complex subunit alpha

Protein alignments

%idAln lengthE-value
MCA_02579_162.500%721.31e-27MCA_02579_1
A0A167EIA7_9ASCO39.572%1871.54e-26Egd2p OS=Sugiyamaella lignohabitans GN=EGD2 PE=4 SV=1
A0A060T643_BLAAD54.545%991.08e-25ARAD1B16434p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1B16434g PE=4 SV=1
UniRef50_Q4WD8153.398%1032.02e-22Nascent polypeptide-associated complex subunit alpha n=179 Tax=Eukaryota TaxID=2759 RepID=NACA_ASPFU
A0A0J9XA81_GEOCN64.384%733.93e-24Similar to Saccharomyces cerevisiae YHR193C EGD2 Alpha subunit of the heteromeric nascent polypeptide-associated complex (NAC) involved in protein sorting and translocation OS=Geotrichum candidum GN=BN980_GECA06s05334g PE=4 SV=1
A0A1E4TBQ1_9ASCO47.525%1012.52e-23Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_28061 PE=4 SV=1
NACA_YARLI47.475%993.95e-18Nascent polypeptide-associated complex subunit alpha OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=EGD2 PE=3 SV=1
NACA_CANAL46.575%734.11e-17Nascent polypeptide-associated complex subunit alpha OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=EGD2 PE=3 SV=1
NACA_YEAST46.479%712.22e-16Nascent polypeptide-associated complex subunit alpha OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=EGD2 PE=1 SV=3
A0A1E3PG51_9ASCO50.515%971.96e-14Nascent polypeptide-associated complex, alpha subunit OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_27346 PE=4 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.0549

Protein family membership

Domains and repeats

  1. Domain
1 20 40 60 80 100 120 140 160 180 200 215

Detailed signature matches

  1. Family IPR016641
    Nascent polypeptide-associated complex subunit alpha
    1. PIRSF015901 (NAC_alpha)
  2. Domain IPR002715
    Nascent polypeptide-associated complex NAC domain
    1. SM01407 (NAC_2)
    2. PS51151 (NAC_AB)
    3. PF01849 (NAC)
Unintegrated signatures no IPR
Unintegrated signatures
  1. mobidb-lite (disord...)

Protein sequence

>MIA_01038_1
MSKIEEIPTESVPEEVKDTGAESETEEIADGSTVTVYSRAEKKARKALIKLGLKKVEGISRVVLRRGQSINFVIANPEVY
RASNSSYIVFGEAKVEDFGALARQASALQAGAAGANPADLAAAAKASGLSAEELEAISKDPASIQADIEAAAAAGGVKKD
EDAPEASEEELIEAGLTKDDIEAIKSQTTASNGAILKAFKDNNKDVINTIVTLTT

GO term prediction

Biological Process

None predicted.

Molecular Function

None predicted.

Cellular Component

GO:0005854 nascent polypeptide-associated complex