Protein
MIA_01012_1
Length
266 amino acids
Browser: contig01:2901456-2902257-
Protein function
EGGNOG: | 0PN6E | MED8 | Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors |
---|---|---|---|
SGD closest match: | S000000397 | MED8 | Mediator of RNA polymerase II transcription subunit 8 |
CGD closest match: | CAL0000185831 | MED8 | Mediator of RNA polymerase II transcription subunit 8 |
Protein alignments
%id | Aln length | E-value | ||
---|---|---|---|---|
MCA_00781_1 | 43.874% | 253 | 1.96e-64 | MCA_00781_1 |
A0A0J9X8G4_GEOCN | 54.375% | 160 | 5.94e-55 | Similar to Saccharomyces cerevisiae YBR193C MED8 Subunit of the RNA polymerase II mediator complex OS=Geotrichum candidum GN=BN980_GECA05s01825g PE=4 SV=1 |
A0A167FE12_9ASCO | 46.626% | 163 | 1.09e-46 | Med8p OS=Sugiyamaella lignohabitans GN=MED8 PE=4 SV=1 |
UniRef50_A0A167FE12 | 46.626% | 163 | 2.99e-43 | Med8p n=4 Tax=Saccharomycetales TaxID=4892 RepID=A0A167FE12_9ASCO |
A0A060TCV1_BLAAD | 48.148% | 162 | 1.22e-46 | ARAD1D38830p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D38830g PE=4 SV=1 |
MED8_YARLI | 47.368% | 152 | 4.48e-44 | Mediator of RNA polymerase II transcription subunit 8 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=MED8 PE=3 SV=1 |
A0A1E3PH87_9ASCO | 48.026% | 152 | 2.08e-42 | Uncharacterized protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_42974 PE=4 SV=1 |
MED8_YEAST | 35.976% | 164 | 2.11e-29 | Mediator of RNA polymerase II transcription subunit 8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MED8 PE=1 SV=3 |
MED8_CANAL | 30.286% | 175 | 3.09e-20 | Mediator of RNA polymerase II transcription subunit 8 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MED8 PE=3 SV=1 |
A0A1E4TD10_9ASCO | 39.216% | 102 | 2.48e-20 | Uncharacterized protein (Fragment) OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_20353 PE=4 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0065
Protein family membership
- Mediator complex, subunit Med8, fungi/metazoa (IPR019364)
- Mediator complex, subunit Med8, fungi (IPR020178)
Domains and repeats
None predicted.
Detailed signature matches
-
-
PF10232 (Med8)
-

Unintegrated signatures
-
mobidb-lite (disord...)
Protein sequence
>MIA_01012_1 MQLNVQEHVVSGGPPQTGPQQPMHLDAQGNMVPMAEEYHADMSAIPINALEFLRLKLTQLTNSLNVMRALLCKPVLPPWP NLHAQFNVILKQLMSLSETLSQYRDILVRTVVYPLPTFPLIAQGASLRSLLRKKATPEVEEWIANARKLAQDSGVDVAAD DEFSVFAAVTVEEELKKHNWNGFLTREQVERGERDRGIRLKKTPQQQNRTASGAPFRGLPAAHNGPGQPRLESLGPPSQR TYEDGGWTIERVIDFMAAGPPETPKT
GO term prediction
Biological Process
GO:0006357 regulation of transcription from RNA polymerase II promoter
Molecular Function
GO:0001104 RNA polymerase II transcription cofactor activity
Cellular Component
GO:0016592 mediator complex