Protein
MCA_00781_1
Length
272 amino acids
Gene name: MED8
Description: Mediator of RNA polymerase II transcription subunit 8
Browser: contigA:2430818-2431637-
RNA-seq: read pairs 580, FPKM 26.3, percentile rank 48.9% (100% = highest expression)
Protein function
| Annotation: | MED8 | Mediator of RNA polymerase II transcription subunit 8 | |
|---|---|---|---|
| KEGG: | K15130 | MED8 | mediator of RNA polymerase II transcription subunit 8, fungi type |
| EGGNOG: | 0PN6E | MED8 | Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors |
| SGD closest match: | S000000397 | MED8 | Mediator of RNA polymerase II transcription subunit 8 |
| CGD closest match: | CAL0000185831 | MED8 | Mediator of RNA polymerase II transcription subunit 8 |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MIA_01012_1 | 43.12% | 276 | 3e-66 | MIA_01012_1 |
| A0A0J9X8G4_GEOCN | 40.54% | 185 | 9e-38 | Similar to Saccharomyces cerevisiae YBR193C MED8 Subunit of the RNA polymerase II mediator complex OS=Geotrichum candidum GN=BN980_GECA05s01825g PE=4 SV=1 |
| A0A167FE12_9ASCO | 36.96% | 184 | 5e-33 | Med8p OS=Sugiyamaella lignohabitans GN=MED8 PE=4 SV=1 |
| UniRef50_A0A167FE12 | 36.96% | 184 | 1e-29 | Med8p n=4 Tax=Saccharomycetales TaxID=4892 RepID=A0A167FE12_9ASCO |
| A0A060TCV1_BLAAD | 34.76% | 187 | 6e-31 | ARAD1D38830p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D38830g PE=4 SV=1 |
| A0A1E3PH87_9ASCO | 29.24% | 236 | 7e-27 | Uncharacterized protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_42974 PE=4 SV=1 |
| MED8_YARLI | 31.32% | 182 | 4e-25 | Mediator of RNA polymerase II transcription subunit 8 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=MED8 PE=3 SV=1 |
| MED8_YEAST | 29.44% | 197 | 2e-17 | Mediator of RNA polymerase II transcription subunit 8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MED8 PE=1 SV=3 |
| A0A1E4TD10_9ASCO | 29.69% | 128 | 8e-14 | Uncharacterized protein (Fragment) OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_20353 PE=4 SV=1 |
| MED8_CANAL | 25.59% | 211 | 2e-12 | Mediator of RNA polymerase II transcription subunit 8 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MED8 PE=3 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0726
Predicted cleavage: 19
Protein family membership
- Mediator complex, subunit Med8, fungi/metazoa (IPR019364)
- Mediator complex, subunit Med8, fungi (IPR020178)
Domains and repeats
None predicted.
Detailed signature matches
-
-
PF10232 (Med8)
-
Protein sequence
>MCA_00781_1 MSANQQQGNTPQPMPQRPMVIATTGTGEEFHADMSAIPINALDIIRLNLVQLTRNISILHHAVLQTTPNNNNLIKGSSSS SSTTSTVGMSNVPAVSWTNIQSQFNVILQHMSLLSEALAANKSLLTNAVVYPLPNFPLTLQAGSLRSLLRKKPTPEVEEW VKEGRTKTIESGLKISQDEAFADFAVTVVEEELRKHEWKGFLSREQVQAGERDPGLKLKTVSKPLVQQKPNIGAPGAPNL PLVQNGFDPISMVYEDGGWPIEKVIAYMNGQF
GO term prediction
Biological Process
GO:0006357 regulation of transcription from RNA polymerase II promoter
Molecular Function
GO:0001104 RNA polymerase II transcription cofactor activity
Cellular Component
GO:0016592 mediator complex