Protein

MIA_00970_1

Length
457 amino acids


Browser: contig01:2761167-2763186+

Protein function

EGGNOG:0PHPDBUR1Serine threonine-protein kinase involved in transcription regulation. Phosphorylates the UBC2 RAD6 ubiquitin- conjugating enzyme (E2), leading to monoubiquitination of histone H2B and the silencing of telomeric-associated genes. Also required for histone H3 methylation. Necessary for the recovery from pheromone-induced growth arrest in the cell cycle G1 phase (By similarity)
SGD closest match:S000005952PHO85Cyclin-dependent protein kinase PHO85
CGD closest match:CAL0000191263CDC28Cyclin-dependent kinase 1

Protein alignments

%idAln lengthE-value
MCA_01357_154.211%1902.60e-56MCA_01357_1
UniRef50_K8FCY140.136%1471.83e-26Uncharacterized protein n=1 Tax=Bathycoccus prasinos TaxID=41875 RepID=K8FCY1_9CHLO
A0A0J9XEC5_GEOCN30.970%2687.32e-28Similar to Saccharomyces cerevisiae YGR040W KSS1 Mitogen-activated protein kinase (MAPK) involved in signal transduction pathways that control filamentous growth and pheromone response OS=Geotrichum candidum GN=BN980_GECA10s01825g PE=4 SV=1
A0A1E3PJF6_9ASCO36.486%1487.58e-26Negative regulator of the PHO system OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_42361 PE=3 SV=1
Q6CF29_YARLI30.824%2797.32e-25YALI0B10758p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_B10758g PE=3 SV=1
A0A167DPB0_9ASCO27.007%2742.22e-24Serine/threonine protein kinase RIM11 OS=Sugiyamaella lignohabitans GN=RIM11 PE=3 SV=1
A0A060T4L0_BLAAD26.740%2732.83e-24ARAD1B04290p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1B04290g PE=3 SV=1
A0A1E4TIQ8_9ASCO45.455%1215.48e-24Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_73709 PE=3 SV=1
CDK1_CANAL30.935%2782.51e-23Cyclin-dependent kinase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CDC28 PE=1 SV=1
PHO85_YEAST38.017%1215.08e-23Cyclin-dependent protein kinase PHO85 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PHO85 PE=1 SV=2

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.3268

Protein family membership

None predicted.

Domains and repeats

1 50 100 150 200 250 300 350 400 457

Detailed signature matches

    1. SSF56112 (Protein k...)
    1. PS50011 (PROTEIN_KI...)
    2. PF00069 (Pkinase)
    1. SM00219 (tyrkin_6)
    1. PS00107 (PROTEIN_KI...)
    1. PS00109 (PROTEIN_KI...)
Unintegrated signatures no IPR
Unintegrated signatures
  1. mobidb-lite (disord...)

Protein sequence

>MIA_00970_1
MSDRYQFLEWVGRGSFAKVRHAKRTYDGGDVAIKEIMRSSFVRDREIYLLDRLWHRNIVNLLDIIYLDAPPPLPLEPTSS
SGGAGGSTTPTPSAPGTAASGPHRNYHHRQQQQQLADPPASEEVIPLLVLDWAPITLDSLMDAFRLPFDIFQLKCFAWQL
IEAVAFLHEHGIVHRDIAPSNILLTTEGIEDGHLTPNVCTLWYRAPEILQHRDYSYPVDMWSYGCVIMELVLGRPLLPGN
SEVDELDRIFRFFEGAPDGPDPALRAPILPSSSTSSIAPSAGSQNPARPSSSSRPLSSRPSSSSSSTSISSAVSSSSSSS
SSHHHHHHHSHQGSRPPAHFLHTRAAYKRARPMDVRERNPQQFSAVQRLLYHLRPVSASHSSSQSSKPPSKSSTSASSSS
SDTQIVPVDHNFISLMEGILTFDPDNRIYAKDAISHGFFYKEPYPCTPIELLARLNA

GO term prediction

Biological Process

GO:0006468 protein phosphorylation

Molecular Function

GO:0004672 protein kinase activity
GO:0004713 protein tyrosine kinase activity
GO:0005524 ATP binding

Cellular Component

None predicted.