Protein

MIA_00952_1

Length
138 amino acids

Browser: contig01:2690030-2690764+

Protein function

EGGNOG:0PNDRFG05999.160S ribosomal protein L27
SGD closest match:S000002879RPL27B60S ribosomal protein L27-B

Protein alignments

%idAln lengthE-value
MCA_00582_279.710%1383.56e-82MCA_00582_2
A0A0J9XGZ7_GEOCN80.435%1381.71e-79Similar to Saccharomyces cerevisiae YHR010W RPL27A Protein component of the large (60S) ribosomal subunit OS=Geotrichum candidum GN=BN980_GECA16s00395g PE=4 SV=1
A0A060T421_BLAAD75.735%1362.86e-73ARAD1C01100p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C01100g PE=4 SV=1
A0A1E3PGV8_9ASCO74.265%1363.82e-72Uncharacterized protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_21615 PE=4 SV=1
RL27B_YEAST70.588%1361.12e-7060S ribosomal protein L27-B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPL27B PE=1 SV=1
UniRef50_P0C2H670.588%1365.19e-6760S ribosomal protein L27-A n=119 Tax=Fungi TaxID=4751 RepID=RL27A_YEAST
A0A1E4TEN3_9ASCO71.852%1357.99e-7060S ribosomal protein L27 OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_1962 PE=3 SV=1
Q6CFL3_YARLI64.029%1396.97e-6460S ribosomal protein L27 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_B05896g PE=3 SV=2
A0A1D8PFG4_CANAL63.971%1363.60e-5860S ribosomal protein L27 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RPL27A PE=3 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.1345
Predicted cleavage: 20

Protein family membership

Domains and repeats

  1. Domain
  2. Domain
1 20 40 60 80 100 120 138

Detailed signature matches

  1. Family IPR001141
    Ribosomal protein L27e
    1. PF01777 (Ribosomal_...)
    2. PD009396
  2. Domain IPR014722
    Ribosomal protein L2 domain 2
    1. G3DSA:2.30.30.30
  3. Domain IPR008991
    Translation protein SH3-like domain
    1. SSF50104 (Translati...)
  4. SITE IPR018262
    Ribosomal protein L27e, conserved site
    1. PS01107 (RIBOSOMAL_...)
Unintegrated signatures no IPR
Unintegrated signatures
  1. cd06090 (KOW_RPL27)

Residue annotation

  1. RNA binding site c...

Protein sequence

>MIA_00952_1
MGSKFLKPGKVAIIVRGRYAGKKVVIIKSQDDGSKSHPFGYALVAGIEKHPQKVTKSHNEKQVAKRNEIKPFIKLVNYNH
IMPTRYTFELDNLKTVISEETFEEGVSQREEAKTTIKKAFEEKHQAGKNTWFFTQLRF

GO term prediction

Biological Process

GO:0006412 translation

Molecular Function

GO:0003735 structural constituent of ribosome

Cellular Component

GO:0005622 intracellular
GO:0005840 ribosome