Protein

MCA_00582_2

Length
138 amino acids

Gene name: RPL27

Description: 60S ribosomal protein L27

Browser: contigA:1796678-1797457-

RNA-seq: read pairs 32431, FPKM 2882.9, percentile rank 98.4% (100% = highest expression)

Protein function

Annotation:RPL2760S ribosomal protein L27
KEGG:K02901RP-L27e large subunit ribosomal protein L27e
EGGNOG:0PNDRFG05999.160S ribosomal protein L27
SGD closest match:S000002879RPL27B60S ribosomal protein L27-B

Protein alignments

%idAln lengthE-value
MIA_00952_179.71%1388e-71MIA_00952_1
A0A0J9XGZ7_GEOCN74.64%1385e-64Similar to Saccharomyces cerevisiae YHR010W RPL27A Protein component of the large (60S) ribosomal subunit OS=Geotrichum candidum GN=BN980_GECA16s00395g PE=4 SV=1
RL27B_YEAST72.06%1366e-6360S ribosomal protein L27-B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPL27B PE=1 SV=1
UniRef50_P0C2H672.06%1362e-5960S ribosomal protein L27-A n=119 Tax=Fungi TaxID=4751 RepID=RL27A_YEAST
A0A060T421_BLAAD74.26%1362e-61ARAD1C01100p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C01100g PE=4 SV=1
A0A1E3PKN2_9ASCO70.37%1353e-58Uncharacterized protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_82868 PE=4 SV=1
A0A1E4TEN3_9ASCO66.67%1352e-5660S ribosomal protein L27 OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_1962 PE=3 SV=1
Q6CFL3_YARLI63.31%1395e-5260S ribosomal protein L27 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_B05896g PE=3 SV=2
A0A1D8PFG4_CANAL68.38%1361e-5160S ribosomal protein L27 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RPL27A PE=3 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.1185
Predicted cleavage: 20

Protein family membership

Domains and repeats

  1. Domain
  2. Domain
1 20 40 60 80 100 120 138

Detailed signature matches

  1. Family IPR001141
    Ribosomal protein L27e
    1. PF01777 (Ribosomal_...)
    2. PD009396
  2. Domain IPR014722
    Ribosomal protein L2 domain 2
    1. G3DSA:2.30.30.30
  3. Domain IPR008991
    Translation protein SH3-like domain
    1. SSF50104 (Translati...)
  4. SITE IPR018262
    Ribosomal protein L27e, conserved site
    1. PS01107 (RIBOSOMAL_...)
Unintegrated signatures no IPR
Unintegrated signatures
  1. Coil
  2. cd06090 (KOW_RPL27)

Residue annotation

  1. RNA binding site c...

Protein sequence

>MCA_00582_2
MGSKFLKQGKAAIIVRGRYAGKKVVIIKPQDDGSKSHPFGYALVAGIESYPKKVTKKHSAEKAAKRSEIKPFIKLVNYNH
LMPTRYSLDVDSLKNVITEETFEEGSSQREQAKAALKKAFEEKNQAGKNSWFFTQLRF

GO term prediction

Biological Process

GO:0006412 translation

Molecular Function

GO:0003735 structural constituent of ribosome

Cellular Component

GO:0005622 intracellular
GO:0005840 ribosome