Protein
MIA_00930_1
Length
371 amino acids
Browser: contig01:2638140-2639256-
Protein function
EGGNOG: | 0PIKZ | PGUG_02209 | fatty acid elongase |
---|---|---|---|
SGD closest match: | S000003732 | ELO1 | Elongation of fatty acids protein 1 |
CGD closest match: | CAL0000179740 | orf19.6007 | Elongation of fatty acids protein |
Protein alignments
%id | Aln length | E-value | ||
---|---|---|---|---|
MCA_02725_1 | 66.927% | 384 | 0.0 | MCA_02725_1 |
A0A167CF52_9ASCO | 71.692% | 325 | 7.85e-178 | Elongation of fatty acids protein OS=Sugiyamaella lignohabitans GN=ELO1 PE=3 SV=1 |
UniRef50_A0A167CF52 | 71.692% | 325 | 2.16e-174 | Elongation of fatty acids protein n=4 Tax=Saccharomycetales TaxID=4892 RepID=A0A167CF52_9ASCO |
A0A060T8G9_BLAAD | 68.750% | 320 | 2.06e-168 | Elongation of fatty acids protein OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D03454g PE=3 SV=1 |
A0A0J9X7E4_GEOCN | 64.478% | 335 | 4.57e-158 | Elongation of fatty acids protein OS=Geotrichum candidum GN=BN980_GECA04s04520g PE=3 SV=1 |
A0A1E3PM11_9ASCO | 60.284% | 282 | 2.38e-120 | Elongation of fatty acids protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_24114 PE=3 SV=1 |
Q6C2L8_YARLI | 52.396% | 313 | 3.11e-103 | Elongation of fatty acids protein OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_F06754g PE=3 SV=1 |
Q5AN96_CANAL | 41.644% | 365 | 4.63e-80 | Elongation of fatty acids protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.6007 PE=3 SV=1 |
A0A1E4TAV7_9ASCO | 30.178% | 169 | 1.01e-16 | Elongation of fatty acids protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_130566 PE=3 SV=1 |
ELO1_YEAST | 31.073% | 177 | 6.42e-16 | Elongation of fatty acids protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ELO1 PE=1 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.5234
Predicted cleavage: 86
Protein family membership
- ELO family (IPR002076)
Domains and repeats
None predicted.
Detailed signature matches
-
-
PF01151 (ELO)
-
no IPR
Unintegrated signatures
-
CYTOPLASMIC_D... (C...)
-
NON_CYTOPLASM... (N...)
-
-
TRANSMEMBRANE (Tran...)
-
mobidb-lite (disord...)
Protein sequence
>MIA_00930_1 MSNSSSVLQTRGSAYISAPNLDAFKLPVGLALPQGPPPGTLFASWFAFFMDIRVPLAIAAIYATLVHLANLLRRSNKEPL ALTRTRAFKWFVLAHNMGLCVYSAWTCAGMSAAIYRTVFELSKAALGSSTDPDTLAQYVAGNTTLLSSAPTNSSGSFWRS LCDINDGIWEQGLSYYGFFFYLSKFYEVLDTVIILAKGRQSSLLQTYHHAGAMLSMWAGIRFASPPIWIFVVFNSLIHTI MYFYYTLSALKVRVPRLLKRALTTAQICQFVFGGSFAVLHMFVYYFNPTTGKYCPCLETPGQLFALLFNVVYLAPLTYLF VNFWIESYVRGWKRADLAKQQQPAEKKPSSPSSASSTAVPPPATTSRSRKD
GO term prediction
Biological Process
None predicted.
Molecular Function
None predicted.
Cellular Component
GO:0016021 integral component of membrane