Protein
MCA_02725_1
Length
385 amino acids
Browser: contigB:2180492-2181650-
RNA-seq: read pairs 12033, FPKM 385.2, percentile rank 93.3% (100% = highest expression)
Protein function
| EGGNOG: | 0PIKZ | PGUG_02209 | fatty acid elongase |
|---|---|---|---|
| SGD closest match: | S000000630 | ELO2 | Elongation of fatty acids protein 2 |
| CGD closest match: | CAL0000179740 | orf19.6007 | Elongation of fatty acids protein |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MIA_00930_1 | 67.28% | 382 | 1e-170 | MIA_00930_1 |
| A0A167CF52_9ASCO | 66.37% | 342 | 4e-156 | Elongation of fatty acids protein OS=Sugiyamaella lignohabitans GN=ELO1 PE=3 SV=1 |
| UniRef50_A0A167CF52 | 66.37% | 342 | 1e-152 | Elongation of fatty acids protein n=4 Tax=Saccharomycetales TaxID=4892 RepID=A0A167CF52_9ASCO |
| A0A060T8G9_BLAAD | 65.48% | 336 | 7e-156 | Elongation of fatty acids protein OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D03454g PE=3 SV=1 |
| A0A0J9X7E4_GEOCN | 61.98% | 334 | 1e-138 | Elongation of fatty acids protein OS=Geotrichum candidum GN=BN980_GECA04s04520g PE=3 SV=1 |
| A0A1E3PM11_9ASCO | 55.97% | 293 | 3e-113 | Elongation of fatty acids protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_24114 PE=3 SV=1 |
| Q6C2L8_YARLI | 53.92% | 293 | 3e-100 | Elongation of fatty acids protein OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_F06754g PE=3 SV=1 |
| Q5AN96_CANAL | 40.59% | 340 | 1e-71 | Elongation of fatty acids protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.6007 PE=3 SV=1 |
| A0A1E4TAV7_9ASCO | 28.73% | 181 | 3e-16 | Elongation of fatty acids protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_130566 PE=3 SV=1 |
| ELO2_YEAST | 27.37% | 190 | 2e-14 | Elongation of fatty acids protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ELO2 PE=1 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.7096
Protein family membership
- ELO family (IPR002076)
Domains and repeats
None predicted.
Detailed signature matches
-
-
PF01151 (ELO)
-
no IPR
Unintegrated signatures
-
CYTOPLASMIC_D... (C...)
-
NON_CYTOPLASM... (N...)
-
-
TRANSMEMBRANE (Tran...)
-
mobidb-lite (disord...)
Protein sequence
>MCA_02725_1 MASSTESNSLLTKGFSYFSTPPSYIFKLPIGLDLPPGPPEGTLFASWFKFFMDVRVPIAIAFTYALSAHIANHFRAKNKE PLALTKTSLFKWLVIAHNLGLCIYSAWTCAGMTSAIYSTVFEVSKKAIAATVDQDQLDLYLNGSQGLLGDNNGQGINLSN IRSNFNNRGFWTGLCDMNDGIWEKGLSYYGFFFYLSKFYEVVDTMIILAKGRQSSLLQTYHHAGAMLSMWAGIRFASPPI WIFVVFNSLIHTIMYFYYTLSALKIKVPKILKRALTTAQICQFLFGGSFALLHMFVYYFKPETSQYTPCLGDSGQLFALL FNVAYLAPLTYLFVMFWIDSYVKNWKKAEDLIKANNAKEEATSKSSSAEVSNTSNSQVKSRSRKD
GO term prediction
Biological Process
None predicted.
Molecular Function
None predicted.
Cellular Component
GO:0016021 integral component of membrane