Protein
MIA_00911_1
Length
142 amino acids
Browser: contig01:2565273-2565702+
Protein function
EGGNOG: | 0PNPT | COX13 | Cytochrome c oxidase polypeptide VIa |
---|---|---|---|
SGD closest match: | S000003159 | COX13 | Cytochrome c oxidase subunit 6A, mitochondrial |
CGD closest match: | CAL0000194951 | COX13 | Cytochrome c oxidase subunit 6A, mitochondrial |
Protein alignments
%id | Aln length | E-value | ||
---|---|---|---|---|
MCA_03731_1 | 59.028% | 144 | 7.06e-53 | MCA_03731_1 |
A0A0J9X7T1_GEOCN | 57.447% | 141 | 3.88e-48 | Similar to Saccharomyces cerevisiae YGL191W COX13 Subunit VIa of cytochrome c oxidase OS=Geotrichum candidum GN=BN980_GECA04s00604g PE=3 SV=1 |
UniRef50_A0A0J9X7T1 | 57.447% | 141 | 7.95e-45 | Similar to Saccharomyces cerevisiae YGL191W COX13 Subunit VIa of cytochrome c oxidase n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9X7T1_GEOCN |
A0A1E3PHR2_9ASCO | 44.531% | 128 | 1.50e-28 | COX6A-domain-containing protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_25022 PE=3 SV=1 |
A0A060T0H8_BLAAD | 42.742% | 124 | 1.78e-27 | ARAD1C16522p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C16522g PE=3 SV=1 |
Q6C325_YARLI | 40.800% | 125 | 4.39e-25 | Cytochrome c oxidase subunit 6A, mitochondrial OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_F03201g PE=3 SV=1 |
A0A167EJB8_9ASCO | 47.945% | 73 | 6.46e-25 | Cytochrome c oxidase subunit 6A, mitochondrial OS=Sugiyamaella lignohabitans GN=COX13 PE=3 SV=1 |
COX13_YEAST | 42.268% | 97 | 6.14e-23 | Cytochrome c oxidase subunit 6A, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=COX13 PE=1 SV=1 |
Q5ALV9_CANAL | 37.500% | 128 | 2.55e-22 | Cytochrome c oxidase subunit 6A, mitochondrial OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=COX13 PE=3 SV=1 |
A0A1E4THV3_9ASCO | 51.948% | 77 | 1.79e-20 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_24332 PE=3 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.9945
Predicted cleavage: 28
Protein family membership
- Cytochrome c oxidase, subunit VIa (IPR001349)
Domains and repeats
None predicted.
Detailed signature matches

Unintegrated signatures
-
CYTOPLASMIC_D... (C...)
-
NON_CYTOPLASM... (N...)
-
-
TRANSMEMBRANE (Tran...)
Protein sequence
>MIA_00911_1 MLSRAFTRKAIAPTLIRRNFSTVKHGHESEVRSAFTYKADATAGAEFIKLEEETAHHSEATAKFWGKVSLFIVVPVIAAT AIHTYIIEKEHFDHLAAHPRLPDSELPPEFDYQNVRTTRFFWGNGDKTLFWNDKFNHKRETE
GO term prediction
Biological Process
None predicted.
Molecular Function
GO:0004129 cytochrome-c oxidase activity
Cellular Component
GO:0005743 mitochondrial inner membrane
GO:0005751 mitochondrial respiratory chain complex IV