Protein

MCA_03731_1

Length
145 amino acids

Gene name: COX13

Description: Cytochrome c oxidase subunit 6A, mitochondrial

Browser: contigC:925012-925450-

RNA-seq: read pairs 44126, FPKM 3734.4, percentile rank 99.0% (100% = highest expression)

Protein function

Annotation:COX13Cytochrome c oxidase subunit 6A, mitochondrial
KEGG:K02266COX6A cytochrome c oxidase subunit 6a
EGGNOG:0PNPTCOX13Cytochrome c oxidase polypeptide VIa
SGD closest match:S000003159COX13Cytochrome c oxidase subunit 6A, mitochondrial
CGD closest match:CAL0000194951COX13Cytochrome c oxidase subunit 6A, mitochondrial

Protein alignments

%idAln lengthE-value
MIA_00911_159.03%1448e-58MIA_00911_1
A0A0J9X7T1_GEOCN53.79%1455e-50Similar to Saccharomyces cerevisiae YGL191W COX13 Subunit VIa of cytochrome c oxidase OS=Geotrichum candidum GN=BN980_GECA04s00604g PE=3 SV=1
UniRef50_A0A0J9X7T153.79%1451e-46Similar to Saccharomyces cerevisiae YGL191W COX13 Subunit VIa of cytochrome c oxidase n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9X7T1_GEOCN
Q6C325_YARLI42.96%1422e-32Cytochrome c oxidase subunit 6A, mitochondrial OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_F03201g PE=3 SV=1
A0A1E3PHR2_9ASCO42.45%1394e-30COX6A-domain-containing protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_25022 PE=3 SV=1
COX13_YEAST43.33%1202e-28Cytochrome c oxidase subunit 6A, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=COX13 PE=1 SV=1
A0A167EJB8_9ASCO35.77%1373e-27Cytochrome c oxidase subunit 6A, mitochondrial OS=Sugiyamaella lignohabitans GN=COX13 PE=3 SV=1
Q5ALV9_CANAL40.74%1082e-25Cytochrome c oxidase subunit 6A, mitochondrial OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=COX13 PE=3 SV=1
A0A060T0H8_BLAAD43.12%1091e-23ARAD1C16522p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C16522g PE=3 SV=1
A0A1E4THV3_9ASCO43.88%982e-18Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_24332 PE=3 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.9834
Predicted cleavage: 24

Protein family membership

Domains and repeats

None predicted.

Detailed signature matches

  1. Family IPR001349
    Cytochrome c oxidase, subunit VIa
    1. PD006036
    2. PF02046 (COX6A)
    3. G3DSA:4.10.95.10
    4. PIRSF000277 (COX_VIa)
    5. SSF81411 (Mitochond...)
Unintegrated signatures no IPR
Unintegrated signatures
  1. TMhelix

Protein sequence

>MCA_03731_1
MLSRAAMLRRAVIPTRTPVLRRAMTTVKPGHESEIRPAFTYAPDKAAAEAFIKLEQETAEHSGKTGDFWLKVSIFVVTPV
ILATAYHTYVVEAEHYKHHKEHPRPSDDELPAEYEYRNIRKTKFFWGDGDKTLFWNPEYNHKKED

GO term prediction

Biological Process

None predicted.

Molecular Function

GO:0004129 cytochrome-c oxidase activity

Cellular Component

GO:0005743 mitochondrial inner membrane
GO:0005751 mitochondrial respiratory chain complex IV