Protein
MCA_03731_1
Length
145 amino acids
Gene name: COX13
Description: Cytochrome c oxidase subunit 6A, mitochondrial
Browser: contigC:925012-925450-
RNA-seq: read pairs 44126, FPKM 3734.4, percentile rank 99.0% (100% = highest expression)
Protein function
Annotation: | COX13 | Cytochrome c oxidase subunit 6A, mitochondrial | |
---|---|---|---|
KEGG: | K02266 | COX6A | cytochrome c oxidase subunit 6a |
EGGNOG: | 0PNPT | COX13 | Cytochrome c oxidase polypeptide VIa |
SGD closest match: | S000003159 | COX13 | Cytochrome c oxidase subunit 6A, mitochondrial |
CGD closest match: | CAL0000194951 | COX13 | Cytochrome c oxidase subunit 6A, mitochondrial |
Protein alignments
%id | Aln length | E-value | ||
---|---|---|---|---|
MIA_00911_1 | 59.03% | 144 | 8e-58 | MIA_00911_1 |
A0A0J9X7T1_GEOCN | 53.79% | 145 | 5e-50 | Similar to Saccharomyces cerevisiae YGL191W COX13 Subunit VIa of cytochrome c oxidase OS=Geotrichum candidum GN=BN980_GECA04s00604g PE=3 SV=1 |
UniRef50_A0A0J9X7T1 | 53.79% | 145 | 1e-46 | Similar to Saccharomyces cerevisiae YGL191W COX13 Subunit VIa of cytochrome c oxidase n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9X7T1_GEOCN |
Q6C325_YARLI | 42.96% | 142 | 2e-32 | Cytochrome c oxidase subunit 6A, mitochondrial OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_F03201g PE=3 SV=1 |
A0A1E3PHR2_9ASCO | 42.45% | 139 | 4e-30 | COX6A-domain-containing protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_25022 PE=3 SV=1 |
COX13_YEAST | 43.33% | 120 | 2e-28 | Cytochrome c oxidase subunit 6A, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=COX13 PE=1 SV=1 |
A0A167EJB8_9ASCO | 35.77% | 137 | 3e-27 | Cytochrome c oxidase subunit 6A, mitochondrial OS=Sugiyamaella lignohabitans GN=COX13 PE=3 SV=1 |
Q5ALV9_CANAL | 40.74% | 108 | 2e-25 | Cytochrome c oxidase subunit 6A, mitochondrial OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=COX13 PE=3 SV=1 |
A0A060T0H8_BLAAD | 43.12% | 109 | 1e-23 | ARAD1C16522p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C16522g PE=3 SV=1 |
A0A1E4THV3_9ASCO | 43.88% | 98 | 2e-18 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_24332 PE=3 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.9834
Predicted cleavage: 24
Protein family membership
- Cytochrome c oxidase, subunit VIa (IPR001349)
Domains and repeats
None predicted.
Detailed signature matches
-
-
-
PF02046 (COX6A)
-
-
PIRSF000277 (COX_VIa)
-
SSF81411 (Mitochond...)
-

Unintegrated signatures
Protein sequence
>MCA_03731_1 MLSRAAMLRRAVIPTRTPVLRRAMTTVKPGHESEIRPAFTYAPDKAAAEAFIKLEQETAEHSGKTGDFWLKVSIFVVTPV ILATAYHTYVVEAEHYKHHKEHPRPSDDELPAEYEYRNIRKTKFFWGDGDKTLFWNPEYNHKKED
GO term prediction
Biological Process
None predicted.
Molecular Function
GO:0004129 cytochrome-c oxidase activity
Cellular Component
GO:0005743 mitochondrial inner membrane
GO:0005751 mitochondrial respiratory chain complex IV