MIA_00837_1

Protein

Length

108 amino acids

EGGNOG:	0PPQA	CYC1	Electron carrier protein. The oxidized form of the cytochrome c heme group can accept an electron from the heme group of the cytochrome c1 subunit of cytochrome reductase. Cytochrome c then transfers this electron to the cytochrome oxidase complex, the final protein carrier in the mitochondrial electron-transport chain
SGD closest match:	S000003809	CYC1	Cytochrome c iso-1
CGD closest match:	CAL0000196284	CYC1	Cytochrome c

	%id	Aln length	E-value
MCA_02313_1	87.037%	108	1.18e-68	MCA_02313_1
CYC_CANAL	87.736%	106	9.80e-67	Cytochrome c OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CYC1 PE=3 SV=3
UniRef50_P53698	87.736%	106	2.38e-63	Cytochrome c n=29 Tax=Dikarya TaxID=451864 RepID=CYC_CANAL
A0A0J9XGD5_GEOCN	84.259%	108	3.94e-66	Similar to Saccharomyces cerevisiae YJR048W CYC1 Cytochrome c, isoform 1 OS=Geotrichum candidum GN=BN980_GECA15s01550g PE=3 SV=1
CYC1_YEAST	84.615%	104	5.71e-65	Cytochrome c iso-1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CYC1 PE=1 SV=2
A0A1E4TEI4_9ASCO	81.481%	108	4.16e-65	Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_31157 PE=3 SV=1
A0A1E3PR77_9ASCO	81.132%	106	5.60e-63	Cytochrome c OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_44625 PE=3 SV=1
A0A167CBB1_9ASCO	80.583%	103	2.00e-62	Cytochrome c isoform 1 OS=Sugiyamaella lignohabitans GN=CYC1 PE=3 SV=1
CYC_YARLI	78.095%	105	9.66e-61	Cytochrome c OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=CYC1 PE=3 SV=1
A0A060TGK7_BLAAD	72.222%	108	6.18e-59	ARAD1D24244p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D24244g PE=3 SV=1

Probability of mitochondrial location: 0.3262
Predicted cleavage: 45

1 10 20 30 40 50 60 70 80 90 100 108

>MIA_00837_1
MGYEPGNSKKGATLFKTRCLQCHTVEAGGPHKVGPNLHGVFGRHSGQAEGYSYTDANKKKGVLWSEETMSEYLENPKKYI
PGTKMAFGGLKKAKDRNDLVTYLKEATS

None predicted.

GO:0009055 electron carrier activity
GO:0020037 heme binding

None predicted.

Filter view on