Protein

MCA_02313_1

Length
108 amino acids


Gene name: CYC1

Description: Cytochrome c iso-1

Browser: contigB:912193-912590-

RNA-seq: read pairs 42669, FPKM 4836.9, percentile rank 99.6% (100% = highest expression)

Protein function

Annotation:CYC1Cytochrome c iso-1
KEGG:K08738CYC cytochrome c
EGGNOG:0PPQACYC1Electron carrier protein. The oxidized form of the cytochrome c heme group can accept an electron from the heme group of the cytochrome c1 subunit of cytochrome reductase. Cytochrome c then transfers this electron to the cytochrome oxidase complex, the final protein carrier in the mitochondrial electron-transport chain
SGD closest match:S000003809CYC1Cytochrome c iso-1
CGD closest match:CAL0000196284CYC1Cytochrome c

Protein alignments

%idAln lengthE-value
MIA_00837_187.04%1084e-67MIA_00837_1
CYC_CANAL86.79%1069e-65Cytochrome c OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CYC1 PE=3 SV=3
UniRef50_P5369886.79%1062e-61Cytochrome c n=29 Tax=Dikarya TaxID=451864 RepID=CYC_CANAL
A0A0J9XGD5_GEOCN85.19%1089e-65Similar to Saccharomyces cerevisiae YJR048W CYC1 Cytochrome c, isoform 1 OS=Geotrichum candidum GN=BN980_GECA15s01550g PE=3 SV=1
A0A1E4TEI4_9ASCO81.48%1082e-62Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_31157 PE=3 SV=1
A0A1E3PR77_9ASCO82.24%1076e-62Cytochrome c OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_44625 PE=3 SV=1
A0A167CBB1_9ASCO82.69%1041e-61Cytochrome c isoform 1 OS=Sugiyamaella lignohabitans GN=CYC1 PE=3 SV=1
CYC1_YEAST82.86%1053e-61Cytochrome c iso-1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CYC1 PE=1 SV=2
CYC_YARLI76.64%1071e-59Cytochrome c OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=CYC1 PE=3 SV=1
A0A060TGK7_BLAAD73.15%1081e-56ARAD1D24244p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D24244g PE=3 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.6193
Predicted cleavage: 45

Protein family membership

Domains and repeats

  1. Domain
1 10 20 30 40 50 60 70 80 90 100 108

Detailed signature matches

    1. PR00604 (CYTCHRMECIAB)
    1. PS51007 (CYTC)
    2. SSF46626 (Cytochrome c)
    3. PF00034 (Cytochrom_C)

Protein sequence

>MCA_02313_1
MGYEAGNAKKGATLFKTRCLQCHTVEKGGPHKVGPNLNGVFGRKSGQAEGYSYTDANKKKGVEWTEDTMFDYLENPKKYI
PGTKMAFGGLKKAKDRNDLIAYLKEACA

GO term prediction

Biological Process

None predicted.

Molecular Function

GO:0009055 electron carrier activity
GO:0020037 heme binding

Cellular Component

None predicted.