Protein
MIA_00827_1
Length
146 amino acids
Browser: contig01:2336502-2337084-
Protein function
EGGNOG: | 0PQSK | FG09974.1 | 60S ribosomal protein L22 |
---|---|---|---|
SGD closest match: | S000004051 | RPL22A | 60S ribosomal protein L22-A |
CGD closest match: | CAL0000196794 | orf19.1409.1 | Ribosomal 60S subunit protein L22B |
Protein alignments
%id | Aln length | E-value | ||
---|---|---|---|---|
A0A0J9XE30_GEOCN | 81.48% | 81 | 1e-42 | Similar to Saccharomyces cerevisiae YLR061W RPL22A Ribosomal 60S subunit protein L22A OS=Geotrichum candidum GN=BN980_GECA11s02892g PE=4 SV=1 |
MCA_06371_1 | 77.27% | 110 | 7e-41 | MCA_06371_1 |
A0A060T2T0_BLAAD | 76.54% | 81 | 3e-39 | ARAD1C27676p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C27676g PE=4 SV=1 |
UniRef50_A0A099P927 | 60.26% | 78 | 2e-26 | Uncharacterized protein n=2 Tax=Pichia kudriavzevii TaxID=4909 RepID=A0A099P927_PICKU |
A0A1E3PDN4_9ASCO | 62.86% | 105 | 7e-25 | 60S ribosomal protein L22 OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_43874 PE=4 SV=1 |
B5FVG4_YARLI | 56.41% | 78 | 3e-18 | YALI0E32208p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_E32208g PE=4 SV=1 |
RL22A_YEAST | 55.84% | 77 | 7e-18 | 60S ribosomal protein L22-A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPL22A PE=1 SV=3 |
A0A1D8PM41_CANAL | 48.75% | 80 | 8e-12 | Ribosomal 60S subunit protein L22B OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.1409.1 PE=4 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.6228
Protein family membership
- Ribosomal protein L22e (IPR002671)
Domains and repeats
None predicted.
Detailed signature matches
-
-
PF01776 (Ribosomal_...)
-

Unintegrated signatures
-
NON_CYTOPLASM... (N...)
-
SIGNAL_PEPTIDE (Sig...)
-
SIGNAL_PEPTID... (S...)
-
SIGNAL_PEPTID... (S...)
-
SIGNAL_PEPTID... (S...)
-
Protein sequence
>MIA_00827_1 MKALLFIGLVFFYLNSFIEAQKKQVILKSPKKYVINVAVNADNEVVDVAALEKFLVEHIKVDGRTSNLGDLVTVTREGNK IIIISLTKFSGKYAKYLTKKFLKKNNLRDWIRLVASSQGEYELKFFNLSVSDDEAEEEDDDEEEEE
GO term prediction
Biological Process
GO:0006412 translation
Molecular Function
GO:0003735 structural constituent of ribosome
Cellular Component
GO:0005622 intracellular
GO:0005840 ribosome