Protein

MIA_00827_1

Length
146 amino acids

Browser: contig01:2336502-2337084-

Protein function

EGGNOG:0PQSKFG09974.160S ribosomal protein L22
SGD closest match:S000004051RPL22A60S ribosomal protein L22-A
CGD closest match:CAL0000196794orf19.1409.1Ribosomal 60S subunit protein L22B

Protein alignments

%idAln lengthE-value
A0A0J9XE30_GEOCN81.48%811e-42Similar to Saccharomyces cerevisiae YLR061W RPL22A Ribosomal 60S subunit protein L22A OS=Geotrichum candidum GN=BN980_GECA11s02892g PE=4 SV=1
MCA_06371_177.27%1107e-41MCA_06371_1
A0A060T2T0_BLAAD76.54%813e-39ARAD1C27676p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C27676g PE=4 SV=1
UniRef50_A0A099P92760.26%782e-26Uncharacterized protein n=2 Tax=Pichia kudriavzevii TaxID=4909 RepID=A0A099P927_PICKU
A0A1E3PDN4_9ASCO62.86%1057e-2560S ribosomal protein L22 OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_43874 PE=4 SV=1
B5FVG4_YARLI56.41%783e-18YALI0E32208p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_E32208g PE=4 SV=1
RL22A_YEAST55.84%777e-1860S ribosomal protein L22-A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPL22A PE=1 SV=3
A0A1D8PM41_CANAL48.75%808e-12Ribosomal 60S subunit protein L22B OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.1409.1 PE=4 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.6228

Protein family membership

Domains and repeats

None predicted.

Detailed signature matches

  1. Family IPR002671
    Ribosomal protein L22e
    1. PF01776 (Ribosomal_...)
Unintegrated signatures no IPR
Unintegrated signatures
  1. NON_CYTOPLASM... (N...)
  2. SIGNAL_PEPTIDE (Sig...)
  3. SIGNAL_PEPTID... (S...)
  4. SIGNAL_PEPTID... (S...)
  5. SIGNAL_PEPTID... (S...)
  6. SignalP-noTM

Protein sequence

>MIA_00827_1
MKALLFIGLVFFYLNSFIEAQKKQVILKSPKKYVINVAVNADNEVVDVAALEKFLVEHIKVDGRTSNLGDLVTVTREGNK
IIIISLTKFSGKYAKYLTKKFLKKNNLRDWIRLVASSQGEYELKFFNLSVSDDEAEEEDDDEEEEE

GO term prediction

Biological Process

GO:0006412 translation

Molecular Function

GO:0003735 structural constituent of ribosome

Cellular Component

GO:0005622 intracellular
GO:0005840 ribosome