Protein

MCA_06371_1

Length
132 amino acids

Browser: contigD:4012104-4012703+

RNA-seq: read pairs 18378, FPKM 1707.4, percentile rank 97.6% (100% = highest expression)

Protein function

KEGG:K02891RP-L22e large subunit ribosomal protein L22e
EGGNOG:0PQSKFG09974.160S ribosomal protein L22
SGD closest match:S000006436RPL22B60S ribosomal protein L22-B
CGD closest match:CAL0000196794orf19.1409.1Ribosomal 60S subunit protein L22B

Protein alignments

%idAln lengthE-value
MIA_00827_177.27%1103e-49MIA_00827_1
A0A0J9XE30_GEOCN69.30%1146e-44Similar to Saccharomyces cerevisiae YLR061W RPL22A Ribosomal 60S subunit protein L22A OS=Geotrichum candidum GN=BN980_GECA11s02892g PE=4 SV=1
A0A1E3PHP6_9ASCO60.68%1172e-3160S ribosomal protein L22 OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_75071 PE=4 SV=1
UniRef50_A0A1E3NNE252.63%1142e-23Uncharacterized protein (Fragment) n=2 Tax=Pichiaceae TaxID=1156497 RepID=A0A1E3NNE2_9ASCO
A0A060T2T0_BLAAD71.25%802e-28ARAD1C27676p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C27676g PE=4 SV=1
B5FVG4_YARLI47.32%1125e-24YALI0E32208p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_E32208g PE=4 SV=1
RL22B_YEAST47.37%1141e-1960S ribosomal protein L22-B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPL22B PE=1 SV=2
A0A1D8PM41_CANAL50.55%915e-13Ribosomal 60S subunit protein L22B OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.1409.1 PE=4 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.1017

Protein family membership

Domains and repeats

None predicted.

Detailed signature matches

  1. Family IPR002671
    Ribosomal protein L22e
    1. PF01776 (Ribosomal_...)
Unintegrated signatures no IPR
Unintegrated signatures
  1. Coil

Protein sequence

>MCA_06371_1
MAPVQKKQIILDAPKKYVINCKVNAENEVVDTAALEKFLVEHIKVDNRTGNLGDLITVDRDGDKIVIVTLTKFSGKYAKF
LVKKFLKKNNLRDWIRVVSVAQGTYELRFFNVSVDDEEEEEEEEDEEEEDEE

GO term prediction

Biological Process

GO:0006412 translation

Molecular Function

GO:0003735 structural constituent of ribosome

Cellular Component

GO:0005622 intracellular
GO:0005840 ribosome