Protein
MCA_06371_1
Length
132 amino acids
Browser: contigD:4012104-4012703+
RNA-seq: read pairs 18378, FPKM 1707.4, percentile rank 97.6% (100% = highest expression)
Protein function
KEGG: | K02891 | RP-L22e | large subunit ribosomal protein L22e |
---|---|---|---|
EGGNOG: | 0PQSK | FG09974.1 | 60S ribosomal protein L22 |
SGD closest match: | S000006436 | RPL22B | 60S ribosomal protein L22-B |
CGD closest match: | CAL0000196794 | orf19.1409.1 | Ribosomal 60S subunit protein L22B |
Protein alignments
%id | Aln length | E-value | ||
---|---|---|---|---|
MIA_00827_1 | 77.27% | 110 | 3e-49 | MIA_00827_1 |
A0A0J9XE30_GEOCN | 69.30% | 114 | 6e-44 | Similar to Saccharomyces cerevisiae YLR061W RPL22A Ribosomal 60S subunit protein L22A OS=Geotrichum candidum GN=BN980_GECA11s02892g PE=4 SV=1 |
A0A1E3PHP6_9ASCO | 60.68% | 117 | 2e-31 | 60S ribosomal protein L22 OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_75071 PE=4 SV=1 |
UniRef50_A0A1E3NNE2 | 52.63% | 114 | 2e-23 | Uncharacterized protein (Fragment) n=2 Tax=Pichiaceae TaxID=1156497 RepID=A0A1E3NNE2_9ASCO |
A0A060T2T0_BLAAD | 71.25% | 80 | 2e-28 | ARAD1C27676p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C27676g PE=4 SV=1 |
B5FVG4_YARLI | 47.32% | 112 | 5e-24 | YALI0E32208p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_E32208g PE=4 SV=1 |
RL22B_YEAST | 47.37% | 114 | 1e-19 | 60S ribosomal protein L22-B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPL22B PE=1 SV=2 |
A0A1D8PM41_CANAL | 50.55% | 91 | 5e-13 | Ribosomal 60S subunit protein L22B OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.1409.1 PE=4 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.1017
Protein family membership
- Ribosomal protein L22e (IPR002671)
Domains and repeats
None predicted.
Detailed signature matches
-
-
PF01776 (Ribosomal_...)
-

Unintegrated signatures
Protein sequence
>MCA_06371_1 MAPVQKKQIILDAPKKYVINCKVNAENEVVDTAALEKFLVEHIKVDNRTGNLGDLITVDRDGDKIVIVTLTKFSGKYAKF LVKKFLKKNNLRDWIRVVSVAQGTYELRFFNVSVDDEEEEEEEEDEEEEDEE
GO term prediction
Biological Process
GO:0006412 translation
Molecular Function
GO:0003735 structural constituent of ribosome
Cellular Component
GO:0005622 intracellular
GO:0005840 ribosome