Protein
MIA_00788_1
Length
85 amino acids
Browser: contig01:2229176-2229562-
Protein function
| EGGNOG: | 0PR7A | splicing factor 3b | |
|---|---|---|---|
| SGD closest match: | S000028509 | YSF3 | RDS3 complex subunit 10 |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MCA_00510_1 | 69.231% | 65 | 1.21e-34 | MCA_00510_1 |
| A0A060T4L5_BLAAD | 62.687% | 67 | 1.82e-28 | ARAD1B04400p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1B04400g PE=4 SV=1 |
| A0A0J9XJC4_GEOCN | 59.375% | 64 | 8.77e-28 | Similar to Saccharomyces cerevisiae YNL138W-A YSF3 Component of the SF3b subcomplex of the U2 snRNP (Partial) (Fragment) OS=Geotrichum candidum GN=BN980_GECA18s02463g PE=4 SV=1 |
| Q6CGS7_YARLI | 52.239% | 67 | 5.97e-23 | YALI0A16566p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_A16566g PE=4 SV=2 |
| UniRef50_Q6CGS7 | 52.239% | 67 | 1.38e-19 | YALI0A16566p n=3 Tax=Saccharomycetales TaxID=4892 RepID=Q6CGS7_YARLI |
| A0A1E3PKA4_9ASCO | 46.774% | 62 | 4.53e-18 | Splicing factor 3B subunit 5/RDS3 complex subunit 10 OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_50909 PE=4 SV=1 |
| YSF3_YEAST | 31.111% | 45 | 5.50e-07 | RDS3 complex subunit 10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YSF3 PE=1 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0182
Protein family membership
Domains and repeats
None predicted.
Detailed signature matches
Protein sequence
>MIA_00788_1 MSTATKKNNDQQQYEQLQNRFIGVGNPDTAKHEWRANIQRDSLASYVGHPPLLTYFSVALGEPHAVTKARFLDVSLLIYL YLSLF
GO term prediction
Biological Process
None predicted.
Molecular Function
None predicted.
Cellular Component
None predicted.