Protein
MCA_00510_1
Length
82 amino acids
Gene name: YSF3
Description: RDS3 complex subunit 10; component of the SF3b subcomplex of the U2 snRNP
Browser: contigA:1606022-1606419-
RNA-seq: read pairs 560, FPKM 83.4, percentile rank 75.9% (100% = highest expression)
Protein function
| Annotation: | YSF3 | RDS3 complex subunit 10; component of the SF3b subcomplex of the U2 snRNP | |
|---|---|---|---|
| KEGG: | K12832 | SF3B5 | splicing factor 3B subunit 5 |
| EGGNOG: | 0PR7A | splicing factor 3b | |
| SGD closest match: | S000028509 | YSF3 | RDS3 complex subunit 10 |
| CGD closest match: | CAL0000175803 | orf19.1150.1 | Uncharacterized protein |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| A0A0J9XJC4_GEOCN | 66.67% | 69 | 7e-34 | Similar to Saccharomyces cerevisiae YNL138W-A YSF3 Component of the SF3b subcomplex of the U2 snRNP (Partial) (Fragment) OS=Geotrichum candidum GN=BN980_GECA18s02463g PE=4 SV=1 |
| MIA_00788_1 | 69.23% | 65 | 4e-33 | MIA_00788_1 |
| A0A060T4L5_BLAAD | 50.72% | 69 | 1e-24 | ARAD1B04400p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1B04400g PE=4 SV=1 |
| Q6CGS7_YARLI | 54.55% | 66 | 6e-24 | YALI0A16566p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_A16566g PE=4 SV=2 |
| UniRef50_Q6CGS7 | 54.55% | 66 | 1e-20 | YALI0A16566p n=3 Tax=Saccharomycetales TaxID=4892 RepID=Q6CGS7_YARLI |
| A0A1E3PKA4_9ASCO | 56.52% | 69 | 8e-24 | Splicing factor 3B subunit 5/RDS3 complex subunit 10 OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_50909 PE=4 SV=1 |
| YSF3_YEAST | 40.00% | 45 | 9e-10 | RDS3 complex subunit 10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YSF3 PE=1 SV=1 |
| A0A1D8PF89_CANAL | 33.85% | 65 | 4e-08 | Uncharacterized protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.1150.1 PE=4 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.5729
Protein family membership
Domains and repeats
None predicted.
Detailed signature matches
Protein sequence
>MCA_00510_1 MVRFFLSFEILRDQQQFEQVQSRFLGVGTPDTTKHEWQSNVHRDTLSSFVGHPAMLTYFSVAMGEPQAVLKAKFLDFIIS RK
GO term prediction
Biological Process
None predicted.
Molecular Function
None predicted.
Cellular Component
None predicted.