Protein

MIA_00780_1

Length
233 amino acids


Browser: contig01:2208037-2208800+

Protein function

EGGNOG:0PMVWSRB2Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors (By similarity)
SGD closest match:S000001083SRB2Mediator of RNA polymerase II transcription subunit 20
CGD closest match:CAL0000177414MED20Med20p

Protein alignments

%idAln lengthE-value
MCA_05809_149.606%2541.15e-81MCA_05809_1
A0A1E3PGD6_9ASCO33.597%2531.15e-37TATA-binding related factor OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_52614 PE=4 SV=1
UniRef50_A0A1E3PGD633.597%2533.11e-34TATA-binding related factor n=1 Tax=Nadsonia fulvescens var. elongata DSM 6958 TaxID=857566 RepID=A0A1E3PGD6_9ASCO
A0A060T8S7_BLAAD40.764%1574.18e-32ARAD1D09790p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D09790g PE=4 SV=1
A0A1D8PLN4_CANAL33.516%1824.70e-24Med20p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MED20 PE=4 SV=1
MED20_YARLI32.353%1703.97e-23Mediator of RNA polymerase II transcription subunit 20 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=SRB2 PE=3 SV=1
A0A0J9XAY6_GEOCN35.811%1481.39e-20Uncharacterized protein OS=Geotrichum candidum GN=BN980_GECA07s03310g PE=4 SV=1
A0A167ESN6_9ASCO50.000%681.11e-16Uncharacterized protein OS=Sugiyamaella lignohabitans GN=AWJ20_1997 PE=4 SV=1
MED20_YEAST23.469%1961.56e-10Mediator of RNA polymerase II transcription subunit 20 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SRB2 PE=1 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.0540

Protein family membership

Domains and repeats

None predicted.

Detailed signature matches

Protein sequence

>MIA_00780_1
MGVTVLYLVSATSPNTIIDVCDLIGNKIPTNVAKWSFEIKLFRENPHSMGPEVTASNNAVNQHIDARSAPPNFLHTLIFS
TNPKETICLVKGVGTALTGPFDQMLQTKLQSLWQLRQSVRGEGTAFELDNGAFWVRLGNMALQGNFRGLLIEIEAAKSET
FWEGSDDPPGPDVTKSPAFRKIKPVLDLLTAQGSPLHGAGGRVIVGPSQLATRTKPFTRVETARQYAEALENR

GO term prediction

Biological Process

GO:0006357 regulation of transcription from RNA polymerase II promoter

Molecular Function

GO:0001104 RNA polymerase II transcription cofactor activity

Cellular Component

GO:0016592 mediator complex