Protein
        MIA_00780_1
Length
        233 amino acids
        
    Browser: contig01:2208037-2208800+
Protein function
| EGGNOG: | 0PMVW | SRB2 | Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors (By similarity) | 
|---|---|---|---|
| SGD closest match: | S000001083 | SRB2 | Mediator of RNA polymerase II transcription subunit 20 | 
| CGD closest match: | CAL0000177414 | MED20 | Med20p | 
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MCA_05809_1 | 49.606% | 254 | 1.15e-81 | MCA_05809_1 | 
| A0A1E3PGD6_9ASCO | 33.597% | 253 | 1.15e-37 | TATA-binding related factor OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_52614 PE=4 SV=1 | 
| UniRef50_A0A1E3PGD6 | 33.597% | 253 | 3.11e-34 | TATA-binding related factor n=1 Tax=Nadsonia fulvescens var. elongata DSM 6958 TaxID=857566 RepID=A0A1E3PGD6_9ASCO | 
| A0A060T8S7_BLAAD | 40.764% | 157 | 4.18e-32 | ARAD1D09790p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D09790g PE=4 SV=1 | 
| A0A1D8PLN4_CANAL | 33.516% | 182 | 4.70e-24 | Med20p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MED20 PE=4 SV=1 | 
| MED20_YARLI | 32.353% | 170 | 3.97e-23 | Mediator of RNA polymerase II transcription subunit 20 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=SRB2 PE=3 SV=1 | 
| A0A0J9XAY6_GEOCN | 35.811% | 148 | 1.39e-20 | Uncharacterized protein OS=Geotrichum candidum GN=BN980_GECA07s03310g PE=4 SV=1 | 
| A0A167ESN6_9ASCO | 50.000% | 68 | 1.11e-16 | Uncharacterized protein OS=Sugiyamaella lignohabitans GN=AWJ20_1997 PE=4 SV=1 | 
| MED20_YEAST | 23.469% | 196 | 1.56e-10 | Mediator of RNA polymerase II transcription subunit 20 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SRB2 PE=1 SV=1 | 
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0540
Protein family membership
- Mediator complex, subunit Med20 (IPR013921)
Domains and repeats
        None predicted.
    
    Detailed signature matches
Protein sequence
>MIA_00780_1 MGVTVLYLVSATSPNTIIDVCDLIGNKIPTNVAKWSFEIKLFRENPHSMGPEVTASNNAVNQHIDARSAPPNFLHTLIFS TNPKETICLVKGVGTALTGPFDQMLQTKLQSLWQLRQSVRGEGTAFELDNGAFWVRLGNMALQGNFRGLLIEIEAAKSET FWEGSDDPPGPDVTKSPAFRKIKPVLDLLTAQGSPLHGAGGRVIVGPSQLATRTKPFTRVETARQYAEALENR
GO term prediction
Biological Process
            GO:0006357 regulation of transcription from RNA polymerase II promoter
                
            
Molecular Function
              GO:0001104 RNA polymerase II transcription cofactor activity
                
            
Cellular Component
                GO:0016592 mediator complex
                
            
