Protein
MCA_05809_1
Length
245 amino acids
Gene name: SRB2
Description: Mediator of RNA polymerase II transcription subunit 20
Browser: contigD:2395555-2396357+
RNA-seq: read pairs 356, FPKM 17.9, percentile rank 38.3% (100% = highest expression)
Protein function
| Annotation: | SRB2 | Mediator of RNA polymerase II transcription subunit 20 | |
|---|---|---|---|
| EGGNOG: | 0PMVW | SRB2 | Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors (By similarity) |
| SGD closest match: | S000001083 | SRB2 | Mediator of RNA polymerase II transcription subunit 20 |
| CGD closest match: | CAL0000177414 | MED20 | Med20p |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MIA_00780_1 | 49.61% | 254 | 4e-80 | MIA_00780_1 |
| A0A1E3PGD6_9ASCO | 34.10% | 261 | 5e-37 | TATA-binding related factor OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_52614 PE=4 SV=1 |
| A0A060T8S7_BLAAD | 40.54% | 148 | 4e-37 | ARAD1D09790p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D09790g PE=4 SV=1 |
| UniRef50_A0A060T8S7 | 40.54% | 148 | 9e-34 | ARAD1D09790p n=1 Tax=Blastobotrys adeninivorans TaxID=409370 RepID=A0A060T8S7_BLAAD |
| MED20_YARLI | 32.34% | 167 | 7e-26 | Mediator of RNA polymerase II transcription subunit 20 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=SRB2 PE=3 SV=1 |
| A0A0J9XAY6_GEOCN | 38.30% | 141 | 1e-23 | Uncharacterized protein OS=Geotrichum candidum GN=BN980_GECA07s03310g PE=4 SV=1 |
| A0A1D8PLN4_CANAL | 31.46% | 178 | 1e-20 | Med20p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MED20 PE=4 SV=1 |
| A0A167ESN6_9ASCO | 60.38% | 53 | 5e-19 | Uncharacterized protein OS=Sugiyamaella lignohabitans GN=AWJ20_1997 PE=4 SV=1 |
| MED20_YEAST | 25.75% | 167 | 2e-11 | Mediator of RNA polymerase II transcription subunit 20 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SRB2 PE=1 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.1260
Protein family membership
- Mediator complex, subunit Med20 (IPR013921)
Domains and repeats
None predicted.
Detailed signature matches
Protein sequence
>MCA_05809_1 MGVTAVYIVSNTSPNMMSSVCDVIGNKIPTNVSKWSFEVKLYRENPHGMGPIDHQQQQSGKVQPNFLYTVTYSNNPKEIV CLVKGVGTLLRGSFDAMLATKLQSLWQLRQTMRGEGTAFEIKGGEYCIRVANMMLQGSFRGLLIEVEYNDRVSFWSPSLS LKPGSKTKNSKAEQNIIPENPQDRLDLSKSESFKEIDKVVKDITNGMIQQTDIRLLPGPPKVIQQTEPFTRVETAWQYVE VLAGR
GO term prediction
Biological Process
GO:0006357 regulation of transcription from RNA polymerase II promoter
Molecular Function
GO:0001104 RNA polymerase II transcription cofactor activity
Cellular Component
GO:0016592 mediator complex