Protein
MIA_00736_1
Length
200 amino acids
Browser: contig01:2083953-2085167+
Protein function
EGGNOG: | 0PNPD | COX5A | cytochrome C oxidase |
---|---|---|---|
SGD closest match: | S000001373 | COX5B | Cytochrome c oxidase polypeptide 5B, mitochondrial |
CGD closest match: | CAL0000179426 | COX5 | Cytochrome c oxidase subunit Va |
Protein alignments
%id | Aln length | E-value | ||
---|---|---|---|---|
MCA_00171_1 | 52.880% | 191 | 1.92e-64 | MCA_00171_1 |
A0A0J9XCC8_GEOCN | 40.217% | 184 | 8.11e-38 | Similar to Saccharomyces cerevisiae YIL111W COX5B Subunit Vb of cytochrome c oxidase OS=Geotrichum candidum GN=BN980_GECA08s00021g PE=4 SV=1 |
UniRef50_A0A0J9XCC8 | 40.217% | 184 | 1.66e-34 | Similar to Saccharomyces cerevisiae YIL111W COX5B Subunit Vb of cytochrome c oxidase n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9XCC8_GEOCN |
A0A060T8G0_BLAAD | 42.982% | 114 | 6.03e-21 | ARAD1C29084p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C29084g PE=4 SV=1 |
A0A167DJU8_9ASCO | 58.333% | 48 | 2.60e-15 | Uncharacterized protein OS=Sugiyamaella lignohabitans GN=AWJ20_1272 PE=4 SV=1 |
A0A1E3PJ07_9ASCO | 42.105% | 76 | 9.54e-15 | Uncharacterized protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_47401 PE=4 SV=1 |
A0A1E4TEJ8_9ASCO | 32.927% | 82 | 5.25e-14 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_102820 PE=4 SV=1 |
Q6C309_YARLI | 36.620% | 71 | 4.78e-13 | YALI0F03567p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_F03567g PE=4 SV=1 |
Q5APK5_CANAL | 29.268% | 82 | 8.59e-10 | Cytochrome c oxidase subunit Va OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=COX5 PE=4 SV=1 |
COX5B_YEAST | 39.623% | 53 | 1.28e-08 | Cytochrome c oxidase polypeptide 5B, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=COX5B PE=1 SV=3 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.9875
Predicted cleavage: 45
Protein family membership
- Cytochrome c oxidase subunit IV family (IPR004203)
Domains and repeats
None predicted.
Detailed signature matches

Unintegrated signatures
-
CYTOPLASMIC_D... (C...)
-
-
NON_CYTOPLASM... (N...)
-
-
TRANSMEMBRANE (Tran...)
-
mobidb-lite (disord...)
Protein sequence
>MIA_00736_1 MISRQCVQRLLTVSSRRTAMMARAYSSAGPVKSSSTTATRKRREEAQALRDSFKFNLIDNGEEDDEALRQKKLKRTYEPN PEVPILDNLAARWDKMDSLDQEEIVLYLEDRMRGDWKDMSDLEKKSALFVAFGPWGPRAQTKDSRSGYEIFVKIILVTMI LVGGYQIANRKAGYLNPPLPENAADIAAGTTEQKEEQPKN
GO term prediction
Biological Process
None predicted.
Molecular Function
GO:0004129 cytochrome-c oxidase activity
Cellular Component
None predicted.