Protein
MCA_00171_1
Length
213 amino acids
Gene name: COX5B
Description: Cytochrome c oxidase polypeptide 5B, mitochondrial
Browser: contigA:500006-501587-
RNA-seq: read pairs 946, FPKM 54.6, percentile rank 67.2% (100% = highest expression)
Protein function
| Annotation: | COX5B | Cytochrome c oxidase polypeptide 5B, mitochondrial | |
|---|---|---|---|
| EGGNOG: | 0PNPD | COX5A | cytochrome C oxidase |
| SGD closest match: | S000001373 | COX5B | Cytochrome c oxidase polypeptide 5B, mitochondrial |
| CGD closest match: | CAL0000179426 | COX5 | Cytochrome c oxidase subunit Va |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MIA_00736_1 | 52.88% | 191 | 5e-63 | MIA_00736_1 |
| A0A0J9XCC8_GEOCN | 47.68% | 151 | 2e-40 | Similar to Saccharomyces cerevisiae YIL111W COX5B Subunit Vb of cytochrome c oxidase OS=Geotrichum candidum GN=BN980_GECA08s00021g PE=4 SV=1 |
| UniRef50_A0A0J9XCC8 | 47.68% | 151 | 5e-37 | Similar to Saccharomyces cerevisiae YIL111W COX5B Subunit Vb of cytochrome c oxidase n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9XCC8_GEOCN |
| A0A060T8G0_BLAAD | 45.69% | 116 | 2e-28 | ARAD1C29084p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C29084g PE=4 SV=1 |
| A0A167DJU8_9ASCO | 40.68% | 118 | 2e-17 | Uncharacterized protein OS=Sugiyamaella lignohabitans GN=AWJ20_1272 PE=4 SV=1 |
| A0A1E3PJ07_9ASCO | 44.59% | 74 | 3e-17 | Uncharacterized protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_47401 PE=4 SV=1 |
| A0A1E4TEJ8_9ASCO | 45.61% | 57 | 9e-14 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_102820 PE=4 SV=1 |
| Q6C309_YARLI | 36.78% | 87 | 5e-13 | YALI0F03567p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_F03567g PE=4 SV=1 |
| Q5APK5_CANAL | 31.40% | 86 | 8e-11 | Cytochrome c oxidase subunit Va OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=COX5 PE=4 SV=1 |
| COX5B_YEAST | 47.27% | 55 | 9e-11 | Cytochrome c oxidase polypeptide 5B, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=COX5B PE=1 SV=3 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.9976
Predicted cleavage: 18
Protein family membership
- Cytochrome c oxidase subunit IV family (IPR004203)
Domains and repeats
None predicted.
Detailed signature matches
no IPR
Unintegrated signatures
-
CYTOPLASMIC_D... (C...)
-
-
NON_CYTOPLASM... (N...)
-
-
TRANSMEMBRANE (Tran...)
Protein sequence
>MCA_00171_1 MISRQVSRSIFQTATRFTTSTGLRANNNTQIIKGFQSALFHNTTASSSAVRKRRDEREALRDAFKLNLMGDDEEEVLSKR KRKSYEPNPEVPILDNLAARWEKMDSLDQEEIALYLEDRMRGDWKDLSELEKKSALFVAYGPWGPRTPSPPNPARGYENF VRVMVAAIIFVTGYQIFTGNAGIFSYPLKKIGKPDDEVEEETKPAATEEQVSK
GO term prediction
Biological Process
None predicted.
Molecular Function
GO:0004129 cytochrome-c oxidase activity
Cellular Component
None predicted.