Protein
MIA_00717_1
Length
209 amino acids
Browser: contig01:2046364-2046994+
Protein function
| EGGNOG: | 0PPUU | DAM1 | Component of the DASH complex, a microtubule-binding subcomplex of the outer kinetochore that is essential for proper chromosome segregation. The DASH complex mediates the formation and maintenance of bipolar kinetochore-microtubule attachments by forming closed rings around spindle microtubules and establishing interactions with proteins from the central kinetochore |
|---|---|---|---|
| SGD closest match: | S000003345 | DAM1 | DASH complex subunit DAM1 |
| CGD closest match: | CAL0000195338 | DAM1 | DASH complex subunit DAM1 |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| A0A0J9XGS6_GEOCN | 56.383% | 94 | 6.89e-29 | Similar to Saccharomyces cerevisiae YGR113W DAM1 Essential subunit of the Dam1 complex OS=Geotrichum candidum GN=BN980_GECA13s03189g PE=4 SV=1 |
| UniRef50_A0A0J9XGS6 | 56.383% | 94 | 1.41e-25 | Similar to Saccharomyces cerevisiae YGR113W DAM1 Essential subunit of the Dam1 complex n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9XGS6_GEOCN |
| MCA_05933_1 | 51.000% | 100 | 1.35e-26 | MCA_05933_1 |
| A0A060THM3_BLAAD | 42.157% | 102 | 2.68e-22 | ARAD1D32318p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D32318g PE=4 SV=1 |
| DAM1_YARLI | 42.105% | 95 | 2.79e-20 | DASH complex subunit DAM1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=DAM1 PE=3 SV=1 |
| A0A167D625_9ASCO | 42.574% | 101 | 2.76e-19 | Dam1p OS=Sugiyamaella lignohabitans GN=DAM1 PE=4 SV=1 |
| A0A1E3PED2_9ASCO | 36.800% | 125 | 1.10e-18 | Uncharacterized protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_84333 PE=4 SV=1 |
| DAM1_YEAST | 41.096% | 73 | 2.82e-13 | DASH complex subunit DAM1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DAM1 PE=1 SV=2 |
| A0A1E4TA00_9ASCO | 34.409% | 93 | 6.05e-12 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_3213 PE=4 SV=1 |
| DAM1_CANAL | 38.095% | 63 | 2.17e-11 | DASH complex subunit DAM1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=DAM1 PE=3 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.4728
Predicted cleavage: 15
Protein family membership
- DASH complex subunit Dam1 (IPR013962)
Domains and repeats
None predicted.
Detailed signature matches
no IPR
Unintegrated signatures
-
-
-
mobidb-lite (disord...)
Protein sequence
>MIA_00717_1 MAHNSRPTTPLRRYSGFSNVSEDEEDTKTPLETTLFSRFVDLNDGFAQLETNMQRMQQVHESITCFNESFSSFLYGIQMN AWCVEFPEAPTSGSFERYSQRLAELAQEKEVREQQEREEIERQRQLELERQRELEIAREKLISEQQQKQQELHKQQHPRY PTRSTATEKRALKRPTDYTPGRPTYGKPPQSKLKSTNGTSRIPTRPSWK
GO term prediction
Biological Process
GO:0008608 attachment of spindle microtubules to kinetochore
Molecular Function
None predicted.
Cellular Component
GO:0042729 DASH complex
GO:0072686 mitotic spindle