Protein

MIA_00717_1

Length
209 amino acids


Browser: contig01:2046364-2046994+

Protein function

EGGNOG:0PPUUDAM1Component of the DASH complex, a microtubule-binding subcomplex of the outer kinetochore that is essential for proper chromosome segregation. The DASH complex mediates the formation and maintenance of bipolar kinetochore-microtubule attachments by forming closed rings around spindle microtubules and establishing interactions with proteins from the central kinetochore
SGD closest match:S000003345DAM1DASH complex subunit DAM1
CGD closest match:CAL0000195338DAM1DASH complex subunit DAM1

Protein alignments

%idAln lengthE-value
A0A0J9XGS6_GEOCN56.383%946.89e-29Similar to Saccharomyces cerevisiae YGR113W DAM1 Essential subunit of the Dam1 complex OS=Geotrichum candidum GN=BN980_GECA13s03189g PE=4 SV=1
UniRef50_A0A0J9XGS656.383%941.41e-25Similar to Saccharomyces cerevisiae YGR113W DAM1 Essential subunit of the Dam1 complex n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9XGS6_GEOCN
MCA_05933_151.000%1001.35e-26MCA_05933_1
A0A060THM3_BLAAD42.157%1022.68e-22ARAD1D32318p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D32318g PE=4 SV=1
DAM1_YARLI42.105%952.79e-20DASH complex subunit DAM1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=DAM1 PE=3 SV=1
A0A167D625_9ASCO42.574%1012.76e-19Dam1p OS=Sugiyamaella lignohabitans GN=DAM1 PE=4 SV=1
A0A1E3PED2_9ASCO36.800%1251.10e-18Uncharacterized protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_84333 PE=4 SV=1
DAM1_YEAST41.096%732.82e-13DASH complex subunit DAM1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DAM1 PE=1 SV=2
A0A1E4TA00_9ASCO34.409%936.05e-12Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_3213 PE=4 SV=1
DAM1_CANAL38.095%632.17e-11DASH complex subunit DAM1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=DAM1 PE=3 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.4728
Predicted cleavage: 15

Protein family membership

Domains and repeats

None predicted.

Detailed signature matches

    1. PF08653 (DASH_Dam1)
Unintegrated signatures no IPR
Unintegrated signatures
  1. mobidb-lite (disord...)

Protein sequence

>MIA_00717_1
MAHNSRPTTPLRRYSGFSNVSEDEEDTKTPLETTLFSRFVDLNDGFAQLETNMQRMQQVHESITCFNESFSSFLYGIQMN
AWCVEFPEAPTSGSFERYSQRLAELAQEKEVREQQEREEIERQRQLELERQRELEIAREKLISEQQQKQQELHKQQHPRY
PTRSTATEKRALKRPTDYTPGRPTYGKPPQSKLKSTNGTSRIPTRPSWK

GO term prediction

Biological Process

GO:0008608 attachment of spindle microtubules to kinetochore

Molecular Function

None predicted.

Cellular Component

GO:0042729 DASH complex
GO:0072686 mitotic spindle