Protein
MCA_05933_1
Length
201 amino acids
Gene name: DAM1
Description: DASH complex subunit DAM1
Browser: contigD:2801331-2801937+
RNA-seq: read pairs 828, FPKM 50.6, percentile rank 65.6% (100% = highest expression)
Protein function
| Annotation: | DAM1 | DASH complex subunit DAM1 | |
|---|---|---|---|
| EGGNOG: | 0PPUU | DAM1 | Component of the DASH complex, a microtubule-binding subcomplex of the outer kinetochore that is essential for proper chromosome segregation. The DASH complex mediates the formation and maintenance of bipolar kinetochore-microtubule attachments by forming closed rings around spindle microtubules and establishing interactions with proteins from the central kinetochore |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| A0A0J9XGS6_GEOCN | 51.06% | 94 | 3e-20 | Similar to Saccharomyces cerevisiae YGR113W DAM1 Essential subunit of the Dam1 complex OS=Geotrichum candidum GN=BN980_GECA13s03189g PE=4 SV=1 |
| UniRef50_A0A0J9XGS6 | 51.06% | 94 | 7e-17 | Similar to Saccharomyces cerevisiae YGR113W DAM1 Essential subunit of the Dam1 complex n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9XGS6_GEOCN |
| MIA_00717_1 | 49.50% | 101 | 6e-19 | MIA_00717_1 |
| DAM1_YARLI | 42.72% | 103 | 2e-17 | DASH complex subunit DAM1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=DAM1 PE=3 SV=1 |
| A0A060THM3_BLAAD | 42.45% | 106 | 2e-14 | ARAD1D32318p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D32318g PE=4 SV=1 |
| A0A1E3PED2_9ASCO | 35.94% | 128 | 3e-13 | Uncharacterized protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_84333 PE=4 SV=1 |
| A0A167D625_9ASCO | 37.62% | 101 | 4e-11 | Dam1p OS=Sugiyamaella lignohabitans GN=DAM1 PE=4 SV=1 |
| A0A1E4TA00_9ASCO | 38.82% | 85 | 8e-08 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_3213 PE=4 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.4064
Predicted cleavage: 14
Protein family membership
- DASH complex subunit Dam1 (IPR013962)
Domains and repeats
None predicted.
Detailed signature matches
no IPR
Unintegrated signatures
-
-
-
mobidb-lite (disord...)
Protein sequence
>MCA_05933_1 MDSIPQPTTPLRRQSESRVAEHFANSKYDIDNPPLETVFKEPLEELSAGYAQLNVNLQNLQQVHESMTSFNESFSAILYG LHINAWCFDFPEGPDSMSFAYYKKIKERIERQRELEEQRRREELERQRQRELELQREREREMERQRQLELQEQQKQQQRV QGTKRNLKRPTDYTPKRPTYGRPPQSKLKKATQPNTRGGWK
GO term prediction
Biological Process
GO:0008608 attachment of spindle microtubules to kinetochore
Molecular Function
None predicted.
Cellular Component
GO:0042729 DASH complex
GO:0072686 mitotic spindle