Protein
MIA_00713_1
Length
122 amino acids
Browser: contig01:2039470-2039921+
Protein function
| EGGNOG: | 0PPNG | FG07088.1 | prefoldin subunit 2 |
|---|---|---|---|
| SGD closest match: | S000000729 | GIM4 | Prefoldin subunit 2 |
| CGD closest match: | CAL0000197543 | orf19.2305 | Tubulin-binding prefolding complex subunit |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MCA_01772_1 | 68.519% | 108 | 1.09e-50 | MCA_01772_1 |
| A0A0J9XBE1_GEOCN | 62.385% | 109 | 1.61e-45 | Similar to Saccharomyces cerevisiae YEL003W GIM4 Subunit of the heterohexameric cochaperone prefoldin complex which binds specifically to cytosolic chaperonin and transfers target proteins to it OS=Geotrichum candidum GN=BN980_GECA08s00395g PE=4 SV=1 |
| A0A1E3PUV7_9ASCO | 57.143% | 105 | 3.29e-38 | Prefoldin beta-like protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_49266 PE=4 SV=1 |
| A0A060T1Y3_BLAAD | 50.000% | 114 | 7.19e-33 | ARAD1C20416p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C20416g PE=4 SV=1 |
| UniRef50_H6C5F5 | 44.538% | 119 | 9.66e-28 | Prefoldin subunit 2 n=105 Tax=Fungi TaxID=4751 RepID=H6C5F5_EXODN |
| B5FVE1_YARLI | 52.830% | 106 | 3.99e-30 | YALI0D06578p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_D06578g PE=4 SV=1 |
| A0A1E4TFA5_9ASCO | 42.593% | 108 | 1.31e-27 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_2114 PE=4 SV=1 |
| PFD2_YEAST | 41.905% | 105 | 6.43e-22 | Prefoldin subunit 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GIM4 PE=1 SV=2 |
| A0A1D8PF30_CANAL | 37.736% | 106 | 7.69e-17 | Tubulin-binding prefolding complex subunit OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.2305 PE=4 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0466
Protein family membership
- Prefoldin beta-like (IPR002777)
Domains and repeats
None predicted.
Detailed signature matches
-
-
PF01920 (Prefoldin_2)
-
no IPR
Unintegrated signatures
-
-
-
SSF46579 (Prefoldin)
Protein sequence
>MIA_00713_1 MSSKQESTVASRPSNAELQEQYNTFKESIAQLSSKIGELEADLDEHNIVLETLKTMPDDRKCFRMIGESLVESTVKEVSP NLQTNSVQLQTVIGTLNKQLEQTKDELKKWQIKYKVQIVPTH
GO term prediction
Biological Process
GO:0006457 protein folding
Molecular Function
GO:0051082 unfolded protein binding
Cellular Component
GO:0016272 prefoldin complex