Protein
MCA_01772_1
Length
120 amino acids
Browser: contigA:5418615-5419103+
RNA-seq: read pairs 750, FPKM 76.6, percentile rank 74.5% (100% = highest expression)
Protein function
KEGG: | K09549 | PFDN2 | prefoldin subunit 2 |
---|---|---|---|
EGGNOG: | 0PPNG | FG07088.1 | prefoldin subunit 2 |
SGD closest match: | S000000729 | GIM4 | Prefoldin subunit 2 |
CGD closest match: | CAL0000197543 | orf19.2305 | Tubulin-binding prefolding complex subunit |
Protein alignments
%id | Aln length | E-value | ||
---|---|---|---|---|
A0A0J9XBE1_GEOCN | 62.30% | 122 | 2e-50 | Similar to Saccharomyces cerevisiae YEL003W GIM4 Subunit of the heterohexameric cochaperone prefoldin complex which binds specifically to cytosolic chaperonin and transfers target proteins to it OS=Geotrichum candidum GN=BN980_GECA08s00395g PE=4 SV=1 |
MIA_00713_1 | 68.52% | 108 | 2e-49 | MIA_00713_1 |
A0A1E3PUV7_9ASCO | 59.81% | 107 | 6e-43 | Prefoldin beta-like protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_49266 PE=4 SV=1 |
UniRef50_H6C5F5 | 49.15% | 118 | 1e-35 | Prefoldin subunit 2 n=105 Tax=Fungi TaxID=4751 RepID=H6C5F5_EXODN |
A0A060T1Y3_BLAAD | 55.14% | 107 | 2e-38 | ARAD1C20416p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C20416g PE=4 SV=1 |
A0A1E4TFA5_9ASCO | 38.94% | 113 | 1e-28 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_2114 PE=4 SV=1 |
B5FVE1_YARLI | 50.47% | 107 | 4e-27 | YALI0D06578p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_D06578g PE=4 SV=1 |
PFD2_YEAST | 41.12% | 107 | 3e-24 | Prefoldin subunit 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GIM4 PE=1 SV=2 |
A0A1D8PF30_CANAL | 33.33% | 123 | 9e-18 | Tubulin-binding prefolding complex subunit OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.2305 PE=4 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0567
Protein family membership
- Prefoldin beta-like (IPR002777)
Domains and repeats
None predicted.
Detailed signature matches
-
-
PF01920 (Prefoldin_2)
-
no IPR
Unintegrated signatures
-
-
-
SSF46579 (Prefoldin)
Protein sequence
>MCA_01772_1 MSTAKPSEEKRPSNQELQIQYNTFKSTIQSLSEKIGELEGDLDEHKLVLGTLKDMPSDRKCFRMVGGTLIESTVKEVVPA LESNSSNLKTVIETLSKDLRKTQEELTKWKVKYKVQIVQS
GO term prediction
Biological Process
GO:0006457 protein folding
Molecular Function
GO:0051082 unfolded protein binding
Cellular Component
GO:0016272 prefoldin complex