MCA_01772_1

Protein

Length

120 amino acids

Browser: contigA:5418615-5419103+

RNA-seq: read pairs 750, FPKM 76.6, percentile rank 74.5% (100% = highest expression)

KEGG:	K09549	PFDN2	prefoldin subunit 2
EGGNOG:	0PPNG	FG07088.1	prefoldin subunit 2
SGD closest match:	S000000729	GIM4	Prefoldin subunit 2
CGD closest match:	CAL0000197543	orf19.2305	Tubulin-binding prefolding complex subunit

	%id	Aln length	E-value
A0A0J9XBE1_GEOCN	62.30%	122	2e-50	Similar to Saccharomyces cerevisiae YEL003W GIM4 Subunit of the heterohexameric cochaperone prefoldin complex which binds specifically to cytosolic chaperonin and transfers target proteins to it OS=Geotrichum candidum GN=BN980_GECA08s00395g PE=4 SV=1
MIA_00713_1	68.52%	108	2e-49	MIA_00713_1
A0A1E3PUV7_9ASCO	59.81%	107	6e-43	Prefoldin beta-like protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_49266 PE=4 SV=1
UniRef50_H6C5F5	49.15%	118	1e-35	Prefoldin subunit 2 n=105 Tax=Fungi TaxID=4751 RepID=H6C5F5_EXODN
A0A060T1Y3_BLAAD	55.14%	107	2e-38	ARAD1C20416p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C20416g PE=4 SV=1
A0A1E4TFA5_9ASCO	38.94%	113	1e-28	Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_2114 PE=4 SV=1
B5FVE1_YARLI	50.47%	107	4e-27	YALI0D06578p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_D06578g PE=4 SV=1
PFD2_YEAST	41.12%	107	3e-24	Prefoldin subunit 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GIM4 PE=1 SV=2
A0A1D8PF30_CANAL	33.33%	123	9e-18	Tubulin-binding prefolding complex subunit OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.2305 PE=4 SV=1

Probability of mitochondrial location: 0.0567

None predicted.

no IPR

Unintegrated signatures

>MCA_01772_1
MSTAKPSEEKRPSNQELQIQYNTFKSTIQSLSEKIGELEGDLDEHKLVLGTLKDMPSDRKCFRMVGGTLIESTVKEVVPA
LESNSSNLKTVIETLSKDLRKTQEELTKWKVKYKVQIVQS

GO:0006457 protein folding

GO:0051082 unfolded protein binding

GO:0016272 prefoldin complex

Filter view on