Protein

MIA_00710_1

Length
242 amino acids

Browser: contig01:2035752-2036481+

Protein function

EGGNOG:0PHF4PRE7The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity (By similarity)
SGD closest match:S000000137PRE7Proteasome subunit beta type-6
CGD closest match:CAL0000182371orf19.2755Proteasome core particle subunit beta 6

Protein alignments

%idAln lengthE-value
MCA_01769_181.857%2373.31e-144MCA_01769_1
A0A0J9X4L8_GEOCN68.803%2341.09e-115Similar to Saccharomyces cerevisiae YBL041W PRE7 Beta 6 subunit of the 20S proteasome OS=Geotrichum candidum GN=BN980_GECA03s01077g PE=4 SV=1
A0A167FQR4_9ASCO65.532%2357.73e-109Proteasome core particle subunit beta 6 OS=Sugiyamaella lignohabitans GN=PRE7 PE=4 SV=1
A0A1E3PTH2_9ASCO66.667%2311.14e-107Beta 6 subunit of the 20S proteasome OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_45130 PE=4 SV=1
A0A1E4TJQ4_9ASCO64.000%2251.79e-103Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_78732 PE=4 SV=1
PSB6_YEAST63.750%2403.57e-103Proteasome subunit beta type-6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRE7 PE=1 SV=1
UniRef50_P2372463.750%2408.55e-100Proteasome subunit beta type-6 n=246 Tax=cellular organisms TaxID=131567 RepID=PSB6_YEAST
Q6CA23_YARLI63.717%2261.21e-96YALI0D06523p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_D06523g PE=4 SV=2
A0A1D8PLK1_CANAL58.776%2451.21e-95Proteasome core particle subunit beta 6 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.2755 PE=4 SV=1
A0A060T6I3_BLAAD58.974%2343.40e-93ARAD1C20350p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C20350g PE=4 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.1549

Protein family membership

Domains and repeats

  1. Domain
1 50 100 150 200 242

Detailed signature matches

  1. Family IPR001353
    Proteasome, subunit alpha/beta
    1. PF00227 (Proteasome)
  2. Family IPR023333
    Proteasome B-type subunit
    1. PS51476 (PROTEASOME...)
  3. Domain IPR029055
    Nucleophile aminohydrolases, N-terminal
    1. G3DSA:3.60.20.10
    2. SSF56235 (N-termina...)
Unintegrated signatures no IPR
Unintegrated signatures
  1. cd03757 (proteasome...)

Residue annotation

  1. active site cd03757
  2. beta subunit inter...

Protein sequence

>MIA_00710_1
MIGTRATQSAEQLAAQNSAPIEHRFNPYDDNGGTIIGIAGDDFVVLAGDTRHSTGYSINTRYRPQVHELGDNMIASASGF
SADSDALIKRLKTRIEWYHHAHNKPLQVASAARLTQTLLYSHRFFPYYVGTIIAGIDPEGKGAIYSFDPVGSYERQTCHA
GGSAASLIVPFLDNQVDFKNQYDPATNLPKKQVNLPLDVVVGLVKDAFTSATERQIQVGDFLEIVIVKKDGITKELVPLK
RD

GO term prediction

Biological Process

GO:0051603 proteolysis involved in cellular protein catabolic process

Molecular Function

GO:0004298 threonine-type endopeptidase activity

Cellular Component

GO:0005839 proteasome core complex