Protein
MCA_01769_1
Length
241 amino acids
Gene name: PRE7
Description: Proteasome subunit beta type-6
Browser: contigA:5414662-5415388+
RNA-seq: read pairs 7526, FPKM 384.3, percentile rank 93.3% (100% = highest expression)
Protein function
| Annotation: | PRE7 | Proteasome subunit beta type-6 | |
|---|---|---|---|
| KEGG: | K02732 | PSMB1 | 20S proteasome subunit beta 6 [EC:3.4.25.1] |
| EGGNOG: | 0PHF4 | PRE7 | The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity (By similarity) |
| SGD closest match: | S000000137 | PRE7 | Proteasome subunit beta type-6 |
| CGD closest match: | CAL0000182371 | orf19.2755 | Proteasome core particle subunit beta 6 |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MIA_00710_1 | 81.86% | 237 | 2e-151 | MIA_00710_1 |
| A0A0J9X4L8_GEOCN | 65.81% | 234 | 3e-118 | Similar to Saccharomyces cerevisiae YBL041W PRE7 Beta 6 subunit of the 20S proteasome OS=Geotrichum candidum GN=BN980_GECA03s01077g PE=4 SV=1 |
| A0A167FQR4_9ASCO | 65.09% | 232 | 2e-115 | Proteasome core particle subunit beta 6 OS=Sugiyamaella lignohabitans GN=PRE7 PE=4 SV=1 |
| A0A1E3PTH2_9ASCO | 62.28% | 228 | 1e-107 | Beta 6 subunit of the 20S proteasome OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_45130 PE=4 SV=1 |
| A0A1E4TJQ4_9ASCO | 60.78% | 232 | 9e-108 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_78732 PE=4 SV=1 |
| PSB6_YEAST | 60.83% | 240 | 7e-107 | Proteasome subunit beta type-6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRE7 PE=1 SV=1 |
| UniRef50_P23724 | 60.83% | 240 | 2e-103 | Proteasome subunit beta type-6 n=246 Tax=cellular organisms TaxID=131567 RepID=PSB6_YEAST |
| Q6CA23_YARLI | 58.80% | 233 | 1e-99 | YALI0D06523p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_D06523g PE=4 SV=2 |
| A0A1D8PLK1_CANAL | 58.75% | 240 | 2e-99 | Proteasome core particle subunit beta 6 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.2755 PE=4 SV=1 |
| A0A060T6I3_BLAAD | 57.45% | 235 | 3e-98 | ARAD1C20350p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C20350g PE=4 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0420
Protein family membership
- Proteasome, subunit alpha/beta (IPR001353)
- Proteasome B-type subunit (IPR023333)
Domains and repeats
-
Domain
1
50
100
150
200
241
Detailed signature matches
no IPR
Unintegrated signatures
-
cd03757 (proteasome...)
Residue annotation
-
active site cd03757
-
beta subunit inter...
Protein sequence
>MCA_01769_1 MFNPSTVSAEQMAAQTNVPVEHRFNPYEDNGGSIIAIAGEDFVILAGDTRHSSGYEINTRYRPQVHEIGDNMIAAANGFS ADGDALLKRLKTKIEWYHHAHNKPLQVASAARLTQTLLYSHRFFPYYVGTIIAGIDPEGKGAVYSFDPVGSYERQTCHAG GAAASLITPFLDNQVDFKNQYDPATGLPKTRVDLPRDTVIDIIRDAFSSATERQIGVGDYLQIVIVTKDGIEKQLFPLKK D
GO term prediction
Biological Process
GO:0051603 proteolysis involved in cellular protein catabolic process
Molecular Function
GO:0004298 threonine-type endopeptidase activity
Cellular Component
GO:0005839 proteasome core complex