Protein

MIA_00661_1

Length
673 amino acids

Browser: contig01:1883781-1885803-

Protein function

EGGNOG:0PFWKPAB1Binds the poly(A) tail of mRNA. Appears to be an important mediator of the multiple roles of the poly(A) tail in mRNA biogenesis, stability and translation. In the nucleus, involved in both mRNA cleavage and polyadenylation. Is also required for efficient mRNA export to the cytoplasm. Acts in concert with a poly(A)-specific nuclease (PAN) to affect poly(A) tail shortening, which may occur concomitantly with either nucleocytoplasmic mRNA transport or translational initiation. In the cytoplasm, stimulates translation initiation and regulates mRNA decay through translation termination-coupled poly(A) shortening, probably mediated by PAN (By similarity)
SGD closest match:S000000967PAB1Polyadenylate-binding protein, cytoplasmic and nuclear
CGD closest match:CAL0000195952PAB1Polyadenylate-binding protein, cytoplasmic and nuclear

Protein alignments

%idAln lengthE-value
MCA_00441_178.268%5890.0MCA_00441_1
A0A0J9XBX2_GEOCN70.034%5940.0Polyadenylate-binding protein OS=Geotrichum candidum GN=BN980_GECA08s03145g PE=3 SV=1
A0A060T6K9_BLAAD64.404%6040.0Polyadenylate-binding protein OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1B16500g PE=3 SV=1
A0A167EIC1_9ASCO61.270%6300.0Polyadenylate-binding protein OS=Sugiyamaella lignohabitans GN=PAB1 PE=3 SV=1
PABP_YARLI57.930%5990.0Polyadenylate-binding protein, cytoplasmic and nuclear OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PAB1 PE=3 SV=1
UniRef50_P3120955.556%5940.0Polyadenylate-binding protein, cytoplasmic and nuclear n=140 Tax=Eukaryota TaxID=2759 RepID=PABP_SCHPO
A0A1E3PFY9_9ASCO58.221%5960.0Polyadenylate-binding protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_47563 PE=3 SV=1
A0A1E4T9Q8_9ASCO72.372%4090.0Polyadenylate-binding protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_70868 PE=3 SV=1
PABP_CANAL57.265%5850.0Polyadenylate-binding protein, cytoplasmic and nuclear OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PAB1 PE=3 SV=1
PABP_YEAST66.176%4080.0Polyadenylate-binding protein, cytoplasmic and nuclear OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PAB1 PE=1 SV=4

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.0874

Protein family membership

Domains and repeats

  1. Domain
1 100 200 300 400 500 600 673

Detailed signature matches

  1. Family IPR006515
    Polyadenylate binding protein, human types 1, 2, 3, 4
    1. TIGR01628
  2. Domain IPR000504
    RNA recognition motif domain
    1. SSF54928 (RNA-bindi...)
    2. PS50102 (RRM)
    3. SM00360 (rrm1_1)
    4. PF00076 (RRM_1)
  3. Domain IPR003954
    RNA recognition motif domain, eukaryote
    1. SM00361 (rrm2_1)
  4. Domain IPR002004
    Polyadenylate-binding protein/Hyperplastic disc protein
    1. PF00658 (PABP)
    2. SM00517 (poly_2)
    3. SSF63570 (PABC (PAB...)
    4. PS51309 (PABC)
Unintegrated signatures no IPR
Unintegrated signatures
  1. Coil
  2. G3DSA:1.10.19...
  3. G3DSA:3.30.70...
  4. cd12378 (RRM1_I_PABPs)
  5. cd12379 (RRM2_I_PABPs)
  6. cd12380 (RRM3_I_PABPs)
  7. cd12381 (RRM4_I_PABPs)
  8. mobidb-lite (disord...)

Residue annotation

  1. RNA binding site c...
  2. oligomer interface...
  3. RNA binding site c...

Protein sequence

>MIA_00661_1
MSTEAVAATEKALEKLNIEETAAPEAEVAPSAATEAPSSTEETSAPATAESASSEVESDSNPSANVSLYVGELDPSISEA
MLFEIFNQIGPVASIRVCRDVVTKRSLGYAYINYHNSADGARALNELNYTPIKGRPCRIMWSQRDPSLRRTGAGNIFIKN
LDPAIDNKDLFDTFSTFGKILSAKIATDDYGNSKGYGFVHFETTEAAESAINNVNGMLLNERKVFVGYHIPKQDRLSKND
ELKAKFTNVYVKNISPETTDDDFKKLFGKYGTITSSTIARDAEGKSRGFGFVNFEKHDAAANAVKELNDFELNGNKLYVG
RAQKKFEREEELKKQYEAARLEKSNMYQGVNLYIKNLDDTIDDDKLRETFSSFGTITSAKVMTDENGKSKGFGFVCFSAP
EEATKAVAEMNQHLVAGKPLYVALAQRKDVRRSQLAQQMQAKNQIRLQQQAAVAGGLPGQYMTPMFYGPGQQPGFMGPVP
GGRPGVPFGGNPQVMLPPRQQVIPPPPQGAWPRNVNGPNQNMLPYMAGGFNGGYGNRVPRPVPFGAQGGRNGGRGQRGPG
PIPAKAGESHLSSLVASAPEEARKQVIGEYIFPKVLNHENIANDPELASKITGMLLEMSVDELINIADDAPAFNNSVHAA
FEAYNEFLQNSANAAPTPAEAAAPAEAPAAASA

GO term prediction

Biological Process

None predicted.

Molecular Function

GO:0003676 nucleic acid binding
GO:0003723 RNA binding

Cellular Component

None predicted.