Protein

MIA_00569_1

Length
275 amino acids


Browser: contig01:1643082-1643994-

Protein function

EGGNOG:0PPMYBNA7Catalyzes the hydrolysis of N-formyl-L-kynurenine to L- kynurenine, the second step in the kynurenine pathway of tryptophan degradation. Kynurenine may be further oxidized to nicotinic acid, NAD(H) and NADP(H). Required for elimination of toxic metabolites (By similarity)
SGD closest match:S000002836BNA7Kynurenine formamidase
CGD closest match:CAL0000192193BNA7Kynurenine formamidase

Protein alignments

%idAln lengthE-value
MCA_04924_143.023%2581.03e-62MCA_04924_1
A0A0J9X4U1_GEOCN36.156%3072.54e-47Similar to Saccharomyces cerevisiae YDR428C BNA7 Formylkynurenine formamidase, involved in the de novo biosynthesis of NAD from tryptophan via kynurenine OS=Geotrichum candidum GN=BN980_GECA02s06456g PE=4 SV=1
UniRef50_A0A0J9X4U136.156%3075.20e-44Similar to Saccharomyces cerevisiae YDR428C BNA7 Formylkynurenine formamidase, involved in the de novo biosynthesis of NAD from tryptophan via kynurenine n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9X4U1_GEOCN
A0A167D7X6_9ASCO33.835%2662.09e-35Kynurenine formamidase OS=Sugiyamaella lignohabitans GN=BNA7 PE=3 SV=1
A0A060TDW1_BLAAD32.432%2592.40e-35ARAD1D03190p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D03190g PE=4 SV=1
A0A1E3PE60_9ASCO32.584%2675.51e-34Kynurenine formamidase OS=Nadsonia fulvescens var. elongata DSM 6958 GN=BNA7 PE=3 SV=1
A0A1E4TGT7_9ASCO33.906%2334.82e-25Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_26848 PE=4 SV=1
Q6CCT4_YARLI26.829%2051.56e-16YALI0C06732p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_C06732g PE=4 SV=1
KFA_YEAST26.891%2382.26e-13Kynurenine formamidase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BNA7 PE=1 SV=1
KFA_CANAL27.111%2251.26e-12Kynurenine formamidase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=BNA7 PE=3 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.0202

Protein family membership

None predicted.

Domains and repeats

  1. Domain
1 50 100 150 200 250 275

Detailed signature matches

    1. SSF53474 (alpha/bet...)

Protein sequence

>MIA_00569_1
MPVDYTAVSYSGTLDAPTDPLRRIGLYKHSSASEYPQFWFIFIHGGAWRDPRIDHTDGLPLISALLKKYPKSLACASIDY
TLAKPLDGSNGRGAQHPDFTLDTLAALTYLRTHHRVEKFALSGHSAGAFMSLQVFIEPKLEETNVFAREKCAAVFGISGI
YSLPLLPIEDASYTGFTEEAFGVDQTLWEVPSVVPYIKGHVAPFPKTTTFKLVIIYSKSDELLNPKFQPVKGPEIYRPIL
GDNNVIVEETVGLHDESYKVQRTADIVEKYLTEYL

GO term prediction

Biological Process

None predicted.

Molecular Function

None predicted.

Cellular Component

None predicted.