Protein

MCA_04924_1

Length
263 amino acids


Gene name: BNA7A

Description: Kynurenine formamidase

Browser: contigC:4442797-4443589+

RNA-seq: read pairs 374, FPKM 17.5, percentile rank 37.8% (100% = highest expression)

Protein function

Annotation:BNA7AKynurenine formamidase
EGGNOG:0PPMYBNA7Catalyzes the hydrolysis of N-formyl-L-kynurenine to L- kynurenine, the second step in the kynurenine pathway of tryptophan degradation. Kynurenine may be further oxidized to nicotinic acid, NAD(H) and NADP(H). Required for elimination of toxic metabolites (By similarity)
SGD closest match:S000002836BNA7Kynurenine formamidase
CGD closest match:CAL0000192193BNA7Kynurenine formamidase

Protein alignments

%idAln lengthE-value
MIA_00569_143.02%2582e-61MIA_00569_1
A0A1E3PE60_9ASCO37.64%2719e-51Kynurenine formamidase OS=Nadsonia fulvescens var. elongata DSM 6958 GN=BNA7 PE=3 SV=1
UniRef50_A0A1E3PE6037.64%2713e-47Kynurenine formamidase n=1 Tax=Nadsonia fulvescens var. elongata DSM 6958 TaxID=857566 RepID=A0A1E3PE60_9ASCO
A0A167D7X6_9ASCO35.69%2692e-48Kynurenine formamidase OS=Sugiyamaella lignohabitans GN=BNA7 PE=3 SV=1
A0A0J9X4U1_GEOCN36.11%2882e-44Similar to Saccharomyces cerevisiae YDR428C BNA7 Formylkynurenine formamidase, involved in the de novo biosynthesis of NAD from tryptophan via kynurenine OS=Geotrichum candidum GN=BN980_GECA02s06456g PE=4 SV=1
A0A060TDW1_BLAAD32.16%2553e-38ARAD1D03190p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D03190g PE=4 SV=1
A0A1E4TGT7_9ASCO37.26%2632e-36Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_26848 PE=4 SV=1
Q6C748_YARLI31.73%2087e-21Kynurenine formamidase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=BNA7 PE=3 SV=1
KFA_CANAL32.47%2313e-20Kynurenine formamidase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=BNA7 PE=3 SV=1
KFA_YEAST29.80%1982e-10Kynurenine formamidase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BNA7 PE=1 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.0689

Protein family membership

None predicted.

Domains and repeats

  1. Domain
1 50 100 150 200 263

Detailed signature matches

    1. SSF53474 (alpha/bet...)

Protein sequence

>MCA_04924_1
MDALDVEIHSYGNQDLQKVAVYKHNSNTLSNLPKRWLIFIHGGAWRDPNNTYEDGNFLISSLLNSFPNVLSAASIKYRLT
SNKPVSAIYPDFVEDLILSLDFLDKNYPIDEFILVGHSAGAFNALACLTPENNLLKAYSNVLSKCKSVIGIAGIYSLPLL
LDEDKSYNGFIEEAFGMNHSAWPLLAEKLASSPLHKDVKLLIVYSKEDELLNYKYQPKYALETFPSILGQQNVTSGITEG
QHEDTYKSPKTVEIITKFLNQLG

GO term prediction

Biological Process

None predicted.

Molecular Function

None predicted.

Cellular Component

None predicted.