Protein

MIA_00523_1

Length
123 amino acids


Browser: contig01:1512815-1513321+

Protein function

EGGNOG:0PQ4URPS2040S ribosomal protein S20
SGD closest match:S000001007RPS2040S ribosomal protein S20
CGD closest match:CAL0000185871RPS20Ribosomal 40S subunit protein S20

Protein alignments

%idAln lengthE-value
MCA_01202_168.033%1229.81e-58MCA_01202_1
A0A060T7T4_BLAAD60.163%1238.54e-50ARAD1B22550p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1B22550g PE=3 SV=1
A0A1E3PIR0_9ASCO64.228%1234.51e-48Ribosomal protein S1 OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_42587 PE=3 SV=1
Q5A389_CANAL62.500%1202.77e-47Ribosomal 40S subunit protein S20 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RPS20 PE=3 SV=1
Q6C569_YARLI59.677%1248.14e-46YALI0E20581p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_E20581g PE=3 SV=1
A0A0J9X7X2_GEOCN57.724%1233.41e-44Similar to Saccharomyces cerevisiae YHL015W RPS20 Protein component of the small (40S) ribosomal subunit OS=Geotrichum candidum GN=BN980_GECA04s01319g PE=3 SV=1
UniRef50_R9XAB756.303%1193.10e-40AaceriABR041Cp n=8 Tax=Opisthokonta TaxID=33154 RepID=R9XAB7_ASHAC
RS20_YEAST58.654%1041.77e-3840S ribosomal protein S20 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPS20 PE=1 SV=3

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.0668

Protein family membership

Domains and repeats

  1. Domain
1 20 40 60 80 100 123

Detailed signature matches

    1. PR00971 (RIBOSOMALS10)
    2. MF_00508 (Ribosomal...)
    1. PF00338 (Ribosomal_S10)
    2. SSF54999 (Ribosomal...)
    3. SM01403 (Ribosomal_...)

Protein sequence

>MIA_00523_1
MSYNKEKEIQDEAPIQKVRVTLTSTKVKEIEKVTADIIKRAAPFTGDKSTDKVVLKGPIRLPTKHLKITTRKTPNGEGSK
TWDTYEMRVHKRVIDLYSNISTVHKITNFHLEPGVDVEITMAQ

GO term prediction

Biological Process

GO:0006412 translation

Molecular Function

GO:0003735 structural constituent of ribosome

Cellular Component

GO:0005840 ribosome
GO:0015935 small ribosomal subunit