Protein

MCA_01202_1

Length
122 amino acids

Gene name: RPS20

Description: 40S ribosomal protein S20

Browser: contigA:3807151-3807926-

RNA-seq: read pairs 43635, FPKM 4383.4, percentile rank 99.3% (100% = highest expression)

Protein function

Annotation:RPS2040S ribosomal protein S20
KEGG:K02969RP-S20e small subunit ribosomal protein S20e
EGGNOG:0PQ4URPS2040S ribosomal protein S20
SGD closest match:S000001007RPS2040S ribosomal protein S20
CGD closest match:CAL0000185871RPS20Ribosomal 40S subunit protein S20

Protein alignments

%idAln lengthE-value
MIA_00523_168.03%1223e-56MIA_00523_1
Q6C569_YARLI61.79%1236e-49YALI0E20581p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_E20581g PE=3 SV=1
A0A1E3PIR0_9ASCO62.60%1234e-47Ribosomal protein S1 OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_42587 PE=3 SV=1
A0A060T7T4_BLAAD61.16%1213e-47ARAD1B22550p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1B22550g PE=3 SV=1
A0A0J9X7X2_GEOCN60.66%1221e-44Similar to Saccharomyces cerevisiae YHL015W RPS20 Protein component of the small (40S) ribosomal subunit OS=Geotrichum candidum GN=BN980_GECA04s01319g PE=3 SV=1
Q5A389_CANAL61.67%1203e-44Ribosomal 40S subunit protein S20 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RPS20 PE=3 SV=1
UniRef50_R9XAB757.98%1196e-39AaceriABR041Cp n=8 Tax=Opisthokonta TaxID=33154 RepID=R9XAB7_ASHAC
RS20_YEAST58.65%1041e-3640S ribosomal protein S20 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPS20 PE=1 SV=3

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.0149

Protein family membership

Domains and repeats

  1. Domain
1 20 40 60 80 100 122

Detailed signature matches

  1. Family IPR001848
    Ribosomal protein S10
    1. PR00971 (RIBOSOMALS10)
    2. MF_00508 (Ribosomal...)
  2. Family IPR005729
    Ribosomal protein S10, eukaryotic/archaeal
    1. TIGR01046
  3. Domain IPR027486
    Ribosomal protein S10 domain
    1. PF00338 (Ribosomal_S10)
    2. SSF54999 (Ribosomal...)
    3. SM01403 (Ribosomal_...)
    4. G3DSA:3.30.70...

Protein sequence

>MCA_01202_1
MNYNKDKEVEETLQIQKVRVTLTSTKVKEIEKVASDIIARAKSLSSPNNPEAKFKGPVRIPTKHLKITTRKTPNGEGSKT
WDSYEMRIHKRIIDLYYPLATVRKITSFKLEPGVEVEVTMAA

GO term prediction

Biological Process

GO:0006412 translation

Molecular Function

GO:0003735 structural constituent of ribosome

Cellular Component

GO:0005840 ribosome
GO:0015935 small ribosomal subunit