Protein
MIA_00418_1
Length
212 amino acids
Browser: contig01:1190586-1191225+
Protein function
EGGNOG: | 0PSB4 | PGUG_04645 | P MRP protein subunit POP5 |
---|---|---|---|
SGD closest match: | S000000031 | POP5 | Ribonuclease P/MRP protein subunit POP5 |
CGD closest match: | CAL0000180724 | orf19.275 | Ribonuclease P/MRP protein subunit POP5 |
Protein alignments
%id | Aln length | E-value | ||
---|---|---|---|---|
MCA_05518_1 | 44.068% | 177 | 2.03e-34 | MCA_05518_1 |
A0A167FYT6_9ASCO | 44.253% | 174 | 9.64e-30 | Ribonuclease P/MRP protein subunit POP5 OS=Sugiyamaella lignohabitans GN=POP5 PE=3 SV=1 |
UniRef50_A0A167FYT6 | 44.253% | 174 | 2.65e-26 | Ribonuclease P/MRP protein subunit POP5 n=3 Tax=Ascomycota TaxID=4890 RepID=A0A167FYT6_9ASCO |
A0A0J9XEX9_GEOCN | 41.885% | 191 | 5.44e-29 | Similar to Saccharomyces cerevisiae YAL033W POP5 Subunit of both RNase MRP and nuclear RNase P OS=Geotrichum candidum GN=BN980_GECA12s03387g PE=4 SV=1 |
A0A060TB49_BLAAD | 41.758% | 182 | 1.02e-29 | Ribonuclease P/MRP protein subunit POP5 OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1B12848g PE=3 SV=1 |
A0A1E3PE08_9ASCO | 39.080% | 174 | 7.02e-27 | Ribonucleases P/MRP protein subunit POP5 (Fragment) OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_14877 PE=4 SV=1 |
Q6CFQ6_YARLI | 35.673% | 171 | 1.90e-22 | Ribonuclease P/MRP protein subunit POP5 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_B04752g PE=3 SV=1 |
Q5AEJ3_CANAL | 36.364% | 176 | 7.76e-22 | Ribonuclease P/MRP protein subunit POP5 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.275 PE=3 SV=1 |
A0A1E4TBN7_9ASCO | 28.070% | 171 | 2.06e-15 | Ribonuclease P/MRP protein subunit POP5 OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_134402 PE=3 SV=1 |
POP5_YEAST | 28.571% | 175 | 6.23e-13 | Ribonuclease P/MRP protein subunit POP5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=POP5 PE=1 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0725
Protein family membership
- Ribonuclease P/MRP protein subunit (IPR002759)
- Ribonuclease P/MRP protein subunit Pop5 (IPR016819)
Domains and repeats
None predicted.
Detailed signature matches
-
-
PF01900 (RNase_P_Rpp14)
-
-
-
PIRSF023803 (RNase_P)
-

Unintegrated signatures
-
SSF160350 (Rnp2-like)
-
mobidb-lite (disord...)
Protein sequence
>MIA_00418_1 MVRLKSRYILFEVLNPEELQILKQQQIKQASDSKASKSSDSNNNPNTHTQITRVNKEIYSKISVASAIQLRQLSIILDSR QLLKLVKESVETHFGIKGSGEVKSTIAVKYFSPRTSTGIIRVARDHVSTVWAALSYITKINNKNVIIRVIRVSGTIKKCE QAAIKRDKQVIDMIGQNYKNEPKKLGINNFGIGTDKPVDSDDDDDYIEDDNL
GO term prediction
Biological Process
GO:0008033 tRNA processing
GO:0016070 RNA metabolic process
Molecular Function
GO:0004526 ribonuclease P activity
GO:0004540 ribonuclease activity
Cellular Component
None predicted.